关于知识产权 知识产权培训 树立尊重知识产权的风尚 知识产权外联 部门知识产权 知识产权和热点议题 特定领域知识产权 专利和技术信息 商标信息 外观设计信息 地理标志信息 植物品种信息(UPOV) 知识产权法律、条约和判决 知识产权资源 知识产权报告 专利保护 商标保护 外观设计保护 地理标志保护 植物品种保护(UPOV) 知识产权争议解决 知识产权局业务解决方案 知识产权服务缴费 谈判与决策 知识产权合作 创新支持 公私伙伴关系 人工智能工具和服务 组织简介 在产权组织任职 问责制 专利 商标 外观设计 地理标志 版权 商业秘密 知识产权的未来 WIPO学院 讲习班和研讨会 知识产权执法 WIPO ALERT 宣传 世界知识产权日 WIPO杂志 案例研究和成功故事 知识产权新闻 产权组织奖 企业 妇女 高校 土著人民 司法机构 青年 审查员 创新生态系统 经济学 金融 无形资产 全球卫生 气候变化 竞争政策 可持续发展目标 遗传资源、传统知识和传统文化表现形式 前沿技术 移动应用 体育 旅游 音乐 时尚 PATENTSCOPE 专利分析 国际专利分类 ARDI - 研究促进创新 ASPI - 专业化专利信息 全球品牌数据库 马德里监视器 Article 6ter Express数据库 尼斯分类 维也纳分类 全球外观设计数据库 国际外观设计公报 Hague Express数据库 洛迦诺分类 Lisbon Express数据库 全球品牌数据库地理标志信息 PLUTO植物品种数据库 GENIE数据库 产权组织管理的条约 WIPO Lex - 知识产权法律、条约和判决 产权组织标准 知识产权统计 WIPO Pearl(术语) 产权组织出版物 国家知识产权概况 产权组织知识中心 全球无形资产投资精要 产权组织技术趋势 全球创新指数 世界知识产权报告 PCT - 国际专利体系 ePCT 布达佩斯 - 国际微生物保藏体系 马德里 - 国际商标体系 eMadrid 第六条之三(徽章、旗帜、国徽) 海牙 - 国际外观设计体系 eHague 里斯本 - 国际地理标志体系 eLisbon UPOV PRISMA 调解 仲裁 专家裁决 域名争议 检索和审查集中式接入(CASE) 数字查询服务(DAS) WIPO Pay 产权组织往来账户 产权组织各大会 常设委员会 会议日历 WIPO Webcast 产权组织正式文件 发展议程 定制化倡议与项目 合作论坛与对话 创新、创意和发展加速计划 知识产权影响力 国家知识产权战略 合作枢纽 技术与创新支持中心(TISC) 技术转移 发明人援助计划(IAP) WIPO GREEN 产权组织的PAT-INFORMED 无障碍图书联合会 产权组织服务创作者 WIPO Translate 语音转文字 分类助手 成员国 观察员 总干事 部门活动 驻外办事处 工作人员职位 附属人员职位 采购 成果和预算 财务报告 监督
Arabic English Spanish French Russian Chinese
法律 条约 判决 按管辖区浏览

The Companies Act, 2004 (Act No. 10 of 2004), 牙买加

返回
WIPO Lex中的最新版本
详情 详情 版本年份 2005 日期 生效: 2005年2月1日 制定: 2004年3月25日 文本类型 知识产权相关法 主题 版权与相关权利(邻接权), 工业产权 主题(二级) 其他

可用资料

主要文本 相关文本
主要文本 主要文本 英语 The Companies Act, 2004 (Act No. 10 of 2004)        
 
開啟 PDF open_in_new
The Companies Act, 2004 (Act No. 10 of 2004)
 The Companies Act, 2004 (Act 10 of 2004)

iThe Companies Act, 2004 [No. ]THE COMPANIES CT, 2004

(Act 10 of 2004)

ARRANGEMENT OF SECTIONS

PART I—Preliminary

1. Short title.

2. Interpretation.

Incorporation of Companies and Matters Incidental Thereto

3. Mode of forming incorporated company.

4. Capacity and powers.

5. Powers reduced.

6. Validity of Acts.

7. Notice not presumed.

Articles of Incorporation

8. Form of articles.

9. Regulations required in case of unlimited company or company limited by guarantee.

10. Alteration of articles by special resolution.

Registration

11. Registration of articles.

12. Effect of registration.

13. Conclusiveness of certificate of incorporation.

14. Registration of unlimited company as limited.

Provisions with respect to Names of Companies

15. Prohibition of registration of companies by undesirable names.

16. Power to dispense with “limited” in name of charitable and other companies.

17. Change of name.

18. Reservation of name.

General Provisions with respect to Articles

19. Effect of articles.

20. Provision as to articles of companies limited by guarantee.

[No. ] The Companies Act, 2004ii

21. Alterations of articles increasing liability to contribute to share capital not to bind existing members without consent.

22. Copies of articles to be given to members.

Membership of Company

23. Definition of member.

24. Membership of holding company.

Private Companies

25. Private companies.

26. Statement in lieu of prospectus to be delivered to Registrar by company ceasing to be private company.

27. Consequences of default in complying with conditions constituting company a private company.

Mutual Fund Companies

27A. Mutual Fund Companies.

Contracts, etc.

28. Form of contracts.

29. Pre-incorporation contracts.

30. Bills of exchange and promissory.

31. Execution of deeds abroad.

32. Company may have official seal for use abroad.

Authentication of Documents

33. Authentication of documents.

PART II—SHARE CAPITAL AND DEBENTURES

34. Minimum share capital.

35. Authorized minimum.

36. Nature of shares.

37. Election to retain par value shares.

38. Consideration.

39. Stated capital accounts.

iiiThe Companies Act, 2004 [No. ]

Prospectus

40. Dating and registration of prospectus.

41. Specific requirements as to particulars in prospectus.

42. Experts consent to issue of prospectus containing statement by him.

43. Restriction on alternation of terms mentioned in prospectus or statement in lieu of prospectus.

44. Civil liability for statements in prospectus.

45. Criminal liability for misstatements in prospectus.

46. Document containing offer of shares or debentures for sale to be deemed prospectus.

47. Interpretation of provisions relating to prospectuses.

Allotment

48. Prohibition of allotment unless minimum subscription received.

49. Prohibition of allotment in certain cases unless statement in lieu of prospectus delivered to Registrar.

50. Effect of irregular allotment.

51. Applications for, and allotment of shares and debentures.

52. Return as to allotments.

Commissions, etc.

53. Power to pay certain commissions, and prohibition of payment of all other commissions, etc.

54. Statement in balance sheet, as to commissions.

Construction of References of Offering Shares or Debentures to the Public

55. Construction of references to offering shares or debentures to public.

Issue of Redeemable Shares

56. Power to issue redeemable shares.

57. Financing etc. of redemption.

58. Power of company to purchase own shares.

59. Alternative acquisition of company’s own shares.

60. Notice to shareholders of purchase by company of own shares.

[No. ] The Companies Act, 2004iv

61. Pre-emptive rights.

62. Power to issue redeemable preference shares.

Miscellaneous Provisions as to Share Capital

63. Power of company to arrange for different amounts being paid on shares.

64. Reserve liability of limited company.

65. Power of company limited by shares to alter its share capital.

66. Notice to Registrar of consolidation of share capital, conversion of shares into stock, etc.

67. Notice of increase of share capital.

68. Power of unlimited company to provide for reserve capital share on registration.

69. Power of company to pay interest out of capital in certain cases.

70. Redemption or cancellation of shares under Employees Share Ownership Plan Act.

Reduction of Share Capital

71. Reduction of stated capital.

72. Effect of redemption, purchase, etc.

Variation of Shareholders’ Rights

73. Rights of holders of special classes of shares.

Transfer of Shares and Debentures, Evidence of Title, etc.

74. Nature and numbering of shares.

75. Transfer not to be registered except on production of instrument of transfer.

76. Registration of transfer on request of transferor.

77. Notice of refusal to register transfer.

78. Certification of transfers.

79. Duties of company with respect to issue of certificates.

80. Certificate evidence of title.

81. Evidence of grant of probate.

82. Issue and effect of share warrants to bearer.

83. Penalty for personation of shareholder.

vThe Companies Act, 2004 [No. ]

Special Provisions as to Debentures

84. Register of debenture holders.

85. Consequences of failure to comply with requirements as to register of debenture holders owing to agent’s default.

86. Inspection of register of debenture holders.

87. Application to registers of debenture holders of certain provisions relating to registers of members.

88. Liability of trustees for debenture holders.

89. Perpetual debentures.

90. Power to re-issue redeemed debentures in certain cases.

91. Specific performance of contracts to subscribe for debentures.

92. Payments of certain debts out of assets subject to floating charge in priority to claims under the charge.

PART III—REGISTRATION OF CHARGES

Registration of Charges with Registrar

93. Registration of charges.

94. Effect of registration.

95. Duty of company to register charges created by company.

96. Duty of company to register charges existing on property acquired.

97. Registrar to keep register charges.

98. Indorsement of certificate of registration on debenturees.

99. Entries of satisfaction and release of property from charge.

100. Rectification of register of charges.

101. Registration of enforcement of security.

Provisions as to Company’s Register of Charges and as to Copies of Instruments creating Charges

102. Copies of instruments creating charges to be kept by company.

103. Company’s register of charges.

104. Right to inspect copies of instruments creating charges and company’s register of charges.

[No. ] The Companies Act, 2004vi

Application of Part III to Companies incorporated outside the Island

105. Application of Part III to charges created, and charges on property subject to charges acquired, by company incorporated outside the Island.

PART IV—MANAGEMENT AND ADMINISTRATION

Registered Office and Name

106. Registered office of company.

107. Publication of name by company.

108. Restriction on commencement of business.

Register of Members

109. Register of members.

110. Index of members of company.

111. Provisions as to entries in register in relation to share warrants.

112. Inspection of register of members and index.

113. Consequences of failure to comply with requirements as to register owing to agent’s default.

114. Power to close register.

115. Power of Court to rectify register.

116. Trusts not to be entered on register.

117. Register to be evidence.

Branch Register

118. Power for company to keep branch register.

119. Regulation as to branch register.

120. Provisions as to branch registers of companies incorporated abroad kept in the Island.

Annual Reports

121. Duty to deliver annual returns.

122. Annual return to be made by company having a share capital.

123. Annual return to be made by company not having share capital.

124. General provisions as to annual returns.

125. Certificates to be sent by private company with annual return.

viiThe Companies Act, 2004 [No. ]

Meetings and Proceedings

126. Annual general meeting.

127. Statutory meeting and statutory report.

128. Convening of extraordinary general meeting on requisition.

129. Length of notice for calling meetings.

130. General provisions as to meetings and votes.

131. Proxies.

132. Right to demand a poll.

133. Voting on a poll.

134. Representation of companies at meetings of other companies and of other creditors.

135. Circulation of members’ resolutions.

136. Circulation of members’ circulars.

137. General provisions affecting sections 135 and 136.

138. Provisions as to extraordinary and special resolutions.

139. Registration and copies of certain resolutions and agreements.

140. Resolutions passed at adjourned meetings.

141. Participation by electronic means.

142. Minutes of proceedings of meetings of company and of directors and managers.

143. Inspection of minute books.

Accounts and Audit

144. Books and documents of account.

145. Profit and loss account and balance sheet.

146. General provisions as to contents and form of accounts.

147. Obligation to lay group accounts before holding company.

148. Form of group accounts.

149. Contents of group accounts.

150. Financial year of holding company and subsidiary.

151. Meaning of “holding company” and “subsidiary”.

[No. ] The Companies Act, 2004viii

152. Requirements relating to balance sheets.

153. Right to receive copies of balance Sheets and auditors’s report.

154. Appointment and remuneration of auditors.

155. Qualification for appointment as auditor.

156. Disqualification for appointment as auditor.

157. Auditor’s report and right of access to books and to attend and be heard at general meetings.

158. Dividends.

159. Exception from the provision of Audited reports.

Inspection

160. Investigation of company’s affairs on application of members.

161. Investigation of company’s affairs in other cases.

162. Power of inspectors to carry investigation into affairs of related companies.

163. Production of documents, and evidence on investigation.

164. Inspector’s report.

165. Proceedings on inspector’s report.

166. Expenses of investigation of company’s affairs.

167. Inspector’s report to be evidence.

168. Appointment and powers of inspectors to investigate ownership of company.

169. Power to require information as to persons interested in shares or debentures.

170. Power to impose restrictions on shares or debentures.

171. Saving for attorneys and bankers.

Directors and other Officers

172. Number of directors and secretary.

173. Avoidance of acts done by persons in dual capacity as director and secretary.

174. Duty of care.

175. Restrictions on appointment or advertisement of director.

ixThe Companies Act, 2004 [No. ]

176. Validity of acts of directors.

177. Share qualifications of directors.

178. Appointments of directors to be voted on individually.

179. Removal of directors.

180. Court disqualified directors.

181. Provisions as to undischarged bankrupts acting as directors.

182. Disqualification for persistent breaches of Act.

183. Register of directors.

184. Illicit loans by company.

185. Permitted loans.

186. Approval of company requisite for payment in connection with transfer of property to director for loss of office, etc.

187. Approval of company required for any payment re transfer of its property to director for loss of office, etc.

188. Duty of director to disclose payment for loss of office, etc. made in connection with transfer of shares in company.

189. Provisions supplementary to sections 186, 187 and 188.

190. Particulars in accounts of directors salaries, pensions, etc.

191. Particulars in accounts of loans to officers, etc.

192. General duty to make disclosure for purposes of sections 190 and 191.

193. Disclosure by directors of interest in contracts.

194. Particulars with respect to directors in trade catalogues, circulars, etc.

195. Director’s service contracts to be open to inspection.

196. Duty of directors to disclose shareholdings in own company.

197. Register of interest notified under section 196.

198. Sanctions for non-compliance.

199. Application of section 196 to spouse and child.

200. Provisions as to assignment of office by directors.

201. Indemnifying directors, etc.

202. For derivative action.

[No. ] The Companies Act, 2004x

203. Right to indemnity.

204. Insurance of directors, etc.

205. Court approval of indemnity.

Arrangements and Reconstructions

206. Power to compromise with creditors and members.

207. Information as to compromises with creditors and members.

208. Provisions for facilitating reconstruction and amalgamation of companies.

209. Power to acquire shares of shareholders dissenting from scheme or contract approved by majority.

210. Scheme of arrangement company and connected person.

211. Power of Court to order pooling of assets.

Complainants Remedies

212. Derivative actions.

213. Court powers.

213A. Remedy in case of Oppression.

PART V—WINDING UP

(i) PRELIMINARY

Modes of Winding Up

214. Modes of Winding up.

Contributories

215. Liability as contributories of present and past members.

216. Definition of contributory.

217. Nature of liability of contributory.

218. Contributories in case of death of member.

219. Contributories in case of bankruptcy of member.

(ii) WINDING UP BY THE COURT

Cases in which Company may be wound up by Court

220. Circumstances in which companies may be wound up by Court.

221. Definition of inability to pay debts.

xiThe Companies Act, 2004 [No. ]

Petition for Winding Up and Effects thereof

222. Provisions as to applications for winding up.

223. Power of Court on hearing petition.

224. Power to stay or restrain proceedings against companies.

225. Avoidance of dispositions of property, etc. after commencement of winding up.

226. Avoidance of attachments, etc.

Commencement of Winding Up

227. Commencement of winding up by the Court.

Consequences of Winding Up Order

228. Copy of order to be forwarded to Registrar.

229. Actions stayed on winding up order.

230. Effect of winding up order.

Trustee in Bankruptcy

231. Trustee in Bankruptcy to be Trustee for winding up purposes.

232. Statement of company’s affairs to be submitted to Trustees.

233. Report by Trustees.

Liquidators

234. Power of Court to appoint liquidators.

235. Appointment and powers of provisional liquidator.

236. Appointment, style, etc. of liquidators.

237. Provisions where person other than Trustee is appointed liquidator.

238. General provisions as to liquidators.

239. Custody of company’s property. -’

240. Vesting of company’s property in liquidator.

241. Powers of liquidator.

242. Exercise and control of liquidator’s powers.

243. Books to be kept by liquidator.

244. Payments of liquidator into bank.

[No. ] The Companies Act, 2004xii

245. Audit of liquidator’s accounts.

246. Control of Registrar over liquidators.

247. Release of liquidator.

Committees of Inspection

248. Meetings of creditors and contributories to determine whether committee of inspection shall be appointed.

249. Constitution and proceedings of committee of inspection.

250. Power of Minister where no committee of inspection.

General Powers of Court in case of Winding Up by Court

251. Power to stay winding up.

252. Settlement of list of contributories and application of assets.

253. Delivery of property to liquidator.

254. Payment of debts due by contributory to company and extent to which set-off allowed.

255. Power of Court to make calls.

256. Payment into bank of moneys due to company.

257. Order on contributory conclusive evidence.

258. Appointment of special manager.

259. Power to exclude creditors not proving in time.

260. Adjustment of rights of contributories.

261. Inspection of books by creditors and contributories.

262. Power to order costs of winding up to be paid out of assets.

263. Power to summon persons suspected of having company property.

264. Power to order public examination of promoters, directors, etc.

265. Procedure at examination.

266. Power to arrest absconding contributory.

267. Powers of Court cumulative.

268. Delegation to liquidator of certain powers of Court.

269. Dissolution of company.

xiiiThe Companies Act, 2004 [No. ]

Enforcement of, and appeal from, orders

270. Power to enforce orders.

271. Appeal from orders.

(iii) Voluntary Winding up

Resolution for, and Commencement of, Voluntary Winding Up

272. Circumstances in which company may be wound up voluntarily.

273. Notice of resolution to wind up voluntarily.

274. Commencement of voluntary winding up.

Consequences of Voluntary Winding Up

275. Effect of voluntary winding up on business and status of company.

276. Avoidance of transfers, etc., after commencement of voluntary winding up.

Declaration of Solvency

277. Statutory declaration of solvency in case of proposal to wind up voluntarily.

Provisions applicable to a Members’ Voluntary Winding Up

278. Provisions applicable to members’ winding up.

279. Power of company to appoint and fix remuneration of liquidators.

280. Power to fill vacancy in office of liquidator.

281. Power of liquidator to accept shares, etc. as consideration for sale of company.

282. Duty of liquidator to call creditors’ meeting in case of insolvency.

283. Duty of liquidator to call general meeting at end of each year.

284. Final meeting and dissolution.

285. Alternative provisions as to annual and final meetings in case of insolvency.

Provisions applicable to a Creditors’ Voluntary Winding Up

286. Provisions applicable to creditor’s winding up.

287. Meeting of creditors.

288. Appointment of liquidator.

289. Appointment of committee of inspection.

[No. ] The Companies Act, 2004xiv

290. Fixing of liquidators’ remuneration and cesser of directors’ powers.

291. Power to fill vacancy in office of liquidator.

292. Application of section 305 to creditors’ winding up.

293. Duty of liquidator to call meetings of company and of creditors at end of each year.

294. Final meeting and dissolution.

Provisions applicable to every Voluntary Winding Up

295. Provision applicable to every voluntary winding up.

296. Distribution of company’s property.

297. Powers and duties of liquidator in voluntary winding up.

298. Power of Court to appoint and remove liquidator in voluntary winding up.

299. Notice by liquidator of his appointment.

300. Arrangement when binding on creditors.

301. Power to apply to Court to have questions determined or powers exercised.

302. Costs of voluntary winding up.

303. Saving for rights of creditors and contributories.

(iv) Winding Up Subject to Supervision of Court

304. Power to order winding up subject to supervision.

305. Effect of petition for winding up subject to supervision.

306. Application of sections 225 and 226 to winding up subject to supervision.

307. Power of Court to appoint or remove liquidators.

308. Effect of supervision order.

(v) Provisions Applicable to every Mode of Winding Up

Proof and Ranking of Claims

309. Debts of all descriptions to be proved.

310. Application of bankruptcy rules in winding up of insolvent companies.

311. Preferential payments.

xvThe Companies Act, 2004 [No. ]

Effect of Winding Up on Antecedent and other Transaction

312. Fraudulent preference.

313. Liabilities and rights of certain fraudulently preferred person.

314. Effect of floating charge.

315. Disclaimer of onerous property.

316. Restriction of rights of creditor as to execution or attachment.

317. Duties of bailiff as to goods taken in execution.

Offences Antecedent to or in Course of Winding Up

318. Offences by officers of companies in liquidation.

319. Penalty for falsification of books.

320. Fraud by officers of companies which have gone into liquidation.

321. Liability where proper accounts not kept.

322. Responsibility for fraudulent trading of persons concerned.

323. Power of Court to assess damages against delinquent directors, etc.

324. Prosecution of delinquent officers and members of company.

Supplementary Provisions as to Winding Up

325. Disqualification for appointment liquidator.

326. Enforcement of duty of liquidator to make returns, etc.

327. Notification that company is in liquidation.

328. Exemption of certain documents from stamp duty on winding up of companies.

329. Books of company to be evidence.

330. Disposal of books and papers of company.

331. Information as to pending liquidations.

332. Unclaimed assets.

333. Resolutions passed at adjourned meetings of creditors and contributories.

Supplementary Powers of Court

334. Meetings to ascertain wishes of creditors or contributories.

335. Affidavits, etc.

[No. ] The Companies Act, 2004xvi

Provisions as to Dissolution

336. Power of Court to declare dissolution of company void.

337. Registrar may strike defunct company off register.

338. Property of dissolved company to be bona vacantia.

339. Power of Crown to disclaim title to property vesting under section 337.

Rules and Fees

340. Rules and fees for winding up.

PART VI—RECEIVERS AND MANAGERS

341. Disqualification for appointment as receiver and for acting as receiver or manager.

342. Power to appoint Trustee as receiver for debenture holders or creditors.

343. Notification that receiver or manager appointed.

344. Power of Court to fix remuneration on application of liquidator.

345. Provisions as to information where receiver or manager appointed.

346. Special provisions as to statement submitted to receiver.

347. Delivery to Registrar of accounts of receivers and managers.

348. Enforcement of duty of receivers and managers to make returns, etc.

349. Liability of receiver for contracts, etc.

350. Construction of references to receivers and managers.

PART VII—REGISTRATION OFFICE AND FEES

351. Registrar of Companies and registration office.

352. Inspection, production and evidence of documents kept by Registrar.

353. Enforcement of duty of company to make returns to Registrar.

PART VIII—APPLICATION OF ACT TO EXISTING COMPANIES

354. Application of Act to existing companies.

PART IX—WINDING UP OF UNREGISTERED COMPANIES

355. Meaning and winding up of unregistered company.

356. Contributories in winding up of unregistered company.

357. Power of Court to stay or restrain proceedings.

358. Action stayed on winding up order.

xviiThe Companies Act, 2004 [No. ]

359. Winding up company incorporated outside the Island.

360. Provisions of Part IX cumulative.

361. Winding up of limited partnership.

PART X—COMPANIES INCORPORATED OUTSIDE THE ISLAND CARRYING ON BUSINESS WITHIN THE ISLAND

362. Companies to which Part X applies.

363. Documents, etc. to be delivered to Registrar by companies carrying on business in the Island.

364. Power of companies incorporated outside Island to hold lands.

365. Return to be delivered to Registrar where documents, etc. altered.

366. Accounts of company carrying on business in Island.

367. Obligation to state name of company, whether limited and country where incorporated.

368. Service on company to which Part X applies.

369. Removing company’s name from register.

370. Penalties.

371. Interpretation of Part X.

PART XI—RESTRICTIONS ON SALE OF SHARES AND OFFERS OF SHARES FOR SALE

372. Provisions with respect to prospectuses of foreign companies inviting subscriptions for shares or offering shares for sale.

373. Additional requirements as to prospectus.

374. Provisions as to expert’s consent and allotment.

375. Penalty for contravention of sections 373, 374 and 375.

376. Civil liability for misstatements in prospectus.

377. Interpretation of provisions as to prospectus.

PART XII—MISCELLANEOUS

Prohibition of Partnership with more than Twenty Members

378. Prohibition of partnerships with more than twenty members.

Provisions relating to Banks

379. Prohibition of banking partnerships with more than ten members.

[No. ] The Companies Act, 2004xviii

Application of certain Provisions of this Act to Unregistered Companies

380. Application of certain provisions of this Act to unregistered companies.

381. Form of registers, etc.

Miscellaneous Offences

382. Penalty for false statement.

383. Penalty for improper use of word “Limited”.

Provisions as to Offences

384. Provision with respect to default fines and meaning of “officer in default”.

385. Prosecution of offences punishable by fine.

386. Production and inspection of books where offence suspected.

Service of Documents and Legal Proceedings

387. Service of documents on company.

388. Costs in actions by certain limited companies.

389. Power of Court to grant relief in certain cases.

390. Saving for privileged communications.

Savings, etc.

391. Savings.

392. Power to alter or add to certain requirements.

393. Power to make rules.

394. Fees.

395. Repeal.

396. Transitional.

FIRST SCHEDULE Tables, A, B, C and D

SECOND SCHEDULE Form of Statement in lieu of Prospectus to be delivered to Registrar by a Private Company on becoming a Public Company and Reports to be set out therein.

THIRD SCHEDULE Matters to be specified in Prospectus and Reports to be set out therein.

xixThe Companies Act, 2004 [No. ]

FOURTH SCHEDULE Form of Statement in lieu of Prospectus to be delivered to Registrar by a Company which does not issue a Prospectus or which does not go to allotment on a Prospectus issued, and Reports to be set out therein.

FIFTH SCHEDULE Contents (Required by Section 119 (3)) and form of Annual Return of a Company having a Share Capital.

SIXTH SCHEDULE Provisions which do not apply in the case of a winding up subject to supervision of the Court.

SEVENTH SCHEDULE Form and content of Company Accounts.

EIGHTH SCHEDULE Matters to be expressly stated inAuditors Report.

NINTH SCHEDULE Provisions referred to in Section 382.

TENTH SCHEDULE Procedure in cases of applications for licences under Section 16.

ELEVENTH SCHEDULE Provisions of this Act applied to the Unregistered companies.

TWELFTH SCHEDULE Exceptions referred to at paragraph (e) of subsection (1) of Section 25.

THIRTEENTH SCHEDULE Exceptions referred to at subsection (3) of Section 25.

FOURTEENTH SCHEDULE Provisions supplementing and interpreting Section 196.

FIFTEENTH SCHEDULE Table of Fees.

1The Companies Act, 2004 [No. ]

Short title and com- mencement.

ANACT to Repeal and replace the CompaniesAct.

[ ]

BE IT ENACTED by The Queen’s Most Excellent Majesty, by and with theadviceandconsentof theSenateandHouseof Representatives of Jamaica, and with the authority of the same, as follows:—

PART I—Preliminary

1. This Act may be cited as the Companies Act, 2004, and shall come into operation on a day to be appointed by the Minister by notice published in the Gazette.

2.—(1) In thisAct unless the context otherwise requires—

“accounts” includes a company’s group accounts whether prepared in the form of accounts or not;

Interpretation.

JAMAICA

No. 10 — 2004

I assent,

[L.S.]

HOWARD F. COOKE, Governor-General

25th day of March, 2004

The date notified by the Minister bringing the Act into operation

[No. ] The Companies Act, 20042

"affiliated" in relation to two or more companies means that—

(a) one of them is the subsidiary of the other;

(b) each of them is a subsidiary of the same company;

(c) each of them is controlled directly or indirectly by the same person; or

(d) each of them by virtue of paragraph (a), (b) or (c) has a relationship with the same company at the same time;

“agent” does not include a person’s counsel acting as such;

“annual return” means the return required to be made, in the case of a company having a share capital, under section 122, and, in the case of a company not having a share capital, under section 123;

“appointed day” means the date of commencement of thisAct;

“articles” means the articles of incorporation of a company as originally framed or as altered by special resolution;

"associate" in relation to any person means—

(a) a company or body corporate of which that person beneficially owns or controls, directly or indirectly, shares or debentures convertible into shares, that carry more than 20 percent of the voting rights—

(i) under all circumstances;

(ii) by reason of the occurrence of an event that is continuing; or

(iii) by reason of a currently exercisable option or right to purchase those shares or those convertible debentures;

(b) a partner of that person acting on behalf of the partnership of which they are partners;

(c) a trust or estate in which that person has a substantial beneficial interest or in respect of which he serves as a trustee or in a similar capacity;

3The Companies Act, 2004 [No. ]

(d) a spouse of that person;

(e) a child, step-child or adopted child of that person;

(f) an immediate relative of that person or of his spouse;

“book and paper” and “book or paper” include accounts, deeds, writings and documents;

“company” means a company formed and registered under this Act or an existing company;

“the Court” used in relation to a company means the Supreme Court;

“debenture” includes debenture stock, bonds and any other securities of a company whether constituting a charge on the assets of the company or not;

“director” includes any person occupying the position of director by whatever name called;

“document” includes, in addition to a document in writing—

(a) any map, plan, graph or drawing;

(b) any photograph;

(c) any disc, tape, sound track or other device in which sounds or other data are embodied so as to be capable (with or without the aid of some other equipment) of being reproduced therefrom;

“existing company” means a company formed and registered before the commencement of this Act under the Law in force before that date;

“file accounts” has the meaning assigned to that expression by subsection (4) of section 25;

“financialyear”means, inrelation toanybodycorporate, theperiod in respect of which any profit and loss account of the body corporate laidbefore it ingeneralmeetingismadeup,whether that period is a year or not;

[No. ] The Companies Act, 20044

“issued generally” means, in relation to a prospectus, issued to persons who are not existing members or debenture holders of the company;

"immediate relative", as respects any person, means his spouse, or his children (including step-children) and their spouses, his parents, his brother or sister;

“officer” in relation to a body corporate includes a director, manager or secretary;

“prescribed” means, as respects the provisions of thisAct relating toprocedure,windingup,andthecostsandfees inconnection therewith, prescribed by rules of court, and as respects the other provisions of thisAct, prescribed by the Minister;

“prospectus” means any prospectus, notice, circular advertisement, or other invitation, offering to the public for subscription or purchase any shares or debentures of a company;

“Registrar” or “Registrar of Companies” means the public officer referred to in section 351;

“rules” means rules provided for in thisAct, and includes rules of court and forms;

“shadow director” in relation to a company, means a person in accordancewithwhosedirectionsor instructions thedirectors of the company are accustomed to act, so, however, that a person is not deemed a shadow director by reason only that the directors act on advice given by him in a professional capacity;

“share” means a share in the share capital of a company, and includes stock except where a distinction between stock and shares is expressed or implied;

“share warrant” has the meaning assigned to that expression by subsection (2) of section 82;

5The Companies Act, 2004 [No. ]

"stated capital" includes—

(a) the total issue price (including consideration other than cash) of all classes of shares;

(b) the full value of transfers to capital by the company fromprofit,or revenuereserves, includingthe total issue price of bonus shares issued upon a capitalization of profits or revenue reserves;

“TableA” means TableAin the First Schedule;

“time of the opening of the subscription lists” has the meaning assigned to that expression by subsection (2) of section 51;

“Trustee” has the meaning assigned to it by section 231.

(2) Aperson shall not be deemed, within the meaning of any provision in thisAct, tobeaperson inaccordancewithwhosedirections or instructions the directors of a company are accustomed to act, by reason only that the directors of the company act on advice given by him in a professional capacity.

(3) Wherever in this Act or in any rules a copy of an order of the Court is required to be served on or delivered to the Registrar the copy so to be served or delivered shall be an office copy.

(4) References in this Act to a body corporate or to a corporation shall be construed as not including a corporation sole but as including a company incorporated outside Jamaica.

(5) Any document filed with the Registrar shall be capable of being read.

Incorporation of Companies and Matters Incidental thereto

3.—(1) One or more persons may form a company by signing and sending articles of incorporation to the Registrar and otherwise complying with the requirements of thisAct in respect of registration.

(2) Such a company may be either—

(a) a company having the liability of its members limited by the articles to theamount, ifany,unpaidonthesharesrespectively

First Schedule.

Mode of forming incorporated company.

[No. ] The Companies Act, 20046

held by them (in this Act termed “a company limited by shares”); or

(b) a company having the liability of its members limited by the articles to such amount as the members may respectively thereby undertake to contribute to the assets of the company in the event of its being wound up (in this Act termed “a company limited by guarantee”) whether or not such a company has a share capital; or

(c) acompanynothavinganylimitonthe liabilityof itsmembers (in thisAct termed “an unlimited company”).

4.—(1) Acompany has the capacity, and, subject to this Act, the rights, powers and privileges of an individual.

(2) Acompany has the capacity to carry on its business, conduct its affairs and exercise its powers in any jurisdiction outside Jamaica to the extent that the laws of Jamaica and of that jurisdiction permit.

(3) It is not necessary for a bylaw to be passed to confer any particular power on a company or its directors.

(4) This section does not authorize any company to carry on any business or activity in breach of—

(a) any enactment prohibiting or restricting the carrying on of the business or activity; or

(b) any provision requiring any permission or licence for the carrying on of the business or activity.

5. A company shall not carry on any business or exercise any power that it is restricted by its articles from carrying on or exercising, nor shall a company exercise any of its powers in a manner contrary to its articles.

6. For the avoidance of doubt, it is hereby declared that, unless otherwise specifically provided in thisAct or any other enactment, an act of a company that is contrary to its articles (including any transfer of property to or by a company) shall not be invalid by reason only that the act is contrary to its articles.

Capacity and powers.

Powers reduced.

Validity of acts.

7The Companies Act, 2004 [No. ]

7. No person shall be affected by, or presumed to have notice or knowledge of, the contents of a document concerning a company by reason only that the document has been filed with the Registrar or is available for inspection at any office of the company.

Articles of Incorporation

8.—(1) Articles of incorporation of a company shall be in the prescribed form and shall set out in respect of the company—

(a) the name of the company with "limited" as the last word of the name in the case of a company limited by shares or by guarantee;

(b) that the registered office of the company is to be situated in the Island;

(c) in the case of a company having a share capital, the classes of shares, if any, and the maximum number of shares, if any, that the company is authorized to issue;

(d) if theright to transfershares in thecompanyis toberestricted, a statement to that effect and giving the nature of the restriction;

(e) thenumberof directors,orthemaximumorminimumnumber of directors of the company;

(f) any restrictions on the business that the company may carry on.

(2) Articles shall—

(a) be printed or typewritten or be in some legible form or other form acceptable to the Registrar;

(b) be divided into paragraphs numbered consecutively;

(c) bear the same stamp as if they were contained in a deed;

(d) be signed by each subscriber of the articles in the presence of at least one witness who must attest the signature.

Notice not presumed.

Form of articles.

[No. ] The Companies Act, 20048

(3) Nothing in this section shall operate to prevent the inclusion in the articles of a company, of provisions with respect to any matter not required by this section to be included in the articles.

(4) The articles of a company referred to in section 11 (a) and (b) shall state that the liability of its members is limited.

(5) The articles of a private company shall contain the matters specified in section 25 (1).

(6) The form of the articles of—

(a) a company limited by shares;

(b) acompanylimitedbyguaranteeandnothavingasharecapital;

(c) a company limited by guarantee and having a share capital;

(d) an unlimited company having a share capital,

may be respectively in accordance with the forms set out in Tables A, B, C and D in the First Schedule, except to the extent that they are excluded in whole or in part or modified.

(7) Acompany having a share capital shall, where applicable, file a document with the Registrar setting out the following—

(a) if two or more classes of shares are issued, the rights, privileges, restrictions and conditions attaching to each class of shares; and

(b) if a class of shares may be issued in a series, the authority given to the directors to fix the number of shares in, and to determine the designation of, and the rights, privileges, restrictions and conditions attaching to the shares of each series.

9.—(1) In the case of an unlimited company or a company limited by guarantee the articles must state the number of members with which the company proposes to be registered and, if the company has a share capital, the amount of share capital with which the company proposes to be registered.

First Schedule.

Regulations required in case of unlimited company or company limited by guarantee.

9The Companies Act, 2004 [No. ]

(2) Where an unlimited company or a company limited by guarantee has increased the number of its members beyond the registered number, it shall, within fifteen days after the increase was resolved on or took place, give to the Registrar notice of the increase, and the Registrar shall record the increase.

(3) If default is made in complying with subsection (2), the company and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

10.—(1) Subject to the provisions of thisAct, a company may by special resolution alter or add to its articles.

(2) Anyalterationoradditionsomadein thearticlesshall, subject to theprovisionsof thisAct,beasvalidas iforiginallycontained therein, and be subject in like manner to alteration by special resolution.

Registration

11. The articles shall be delivered to the Registrar who shall—

(a) retain and register them if the articles comply, with the provisions of thisAct; or

(b) where the articles are not in compliance, require that they be amended to ensure such compliance.

12.—(1)Onthe registrationof thearticlesofacompany theRegistrar shall certify under his hand that the company is incorporated and, in the case of a limited company, that the company is limited.

(2) From the date of incorporation mentioned in the certificate of incorporation, thesubscribersof thearticles, togetherwithsuch other persons as may from time to time become members of the company, shallbeacompanybythenamecontainedinthearticles,capableforthwith of exercising all the functions of an incorporated company, and having perpetual succession and a common seal, but with such liability on the part of the members to contribute to the assets of the company in the event of its being wound up as is mentioned in thisAct.

13.—(1)Acertificateof incorporationgivenbytheRegistrar inrespect of any association shall be conclusive evidence that all the requirements

Alteration of articles by special resolution.

Registration of articles.

Effect of registration.

Conclusiveness of certificate of incorporation.

[No. ] The Companies Act, 200410

of this Act in respect of registration and of matters precedent and incidental thereto have been complied with, and that the association is a company authorized to be registered and duly registered under this Act.

(2) Astatutory declaration by an attorney-at-law engaged in the formation of the company, or by a person named in the articles as a director or secretary of the company, or by a person who is a member of the Institute of Chartered Secretaries andAdministrators engaged in the formation of the company, of compliance with all or any of the said requirements shall be produced to the Registrar, and the Registrar may accept such a declaration as sufficient evidence of compliance.

14.—(1) Subject to the provisions of this section, a company registered as unlimited may register under this Act as limited, or a company already registered as a limited company may re-register under this Act, but the registration of an unlimited company as a limited companyshallnotaffect the rightsor liabilitiesof thecompanyinrespect of any debt or obligation incurred, or any contract entered into, by, to, with or on behalf of the company before the registration, and those rights or liabilities may be enforced as provided by thisAct in the same manner in all respects as if no such change of registration had taken place.

(2) On registration in pursuance of this section the Registrar shall close the former registration of the company, and may dispense with the delivery to him of copies of any documents with copies of which he was furnished on the occasion of the original registration of the company, but, save as aforesaid, the registration shall take place in the same manner and shall have effect as if it were the first registration of the company under thisAct.

(3) Where a company limited by shares re-registers as a company limited by guarantee, the amount of the guarantee shall not be less than the amount remaining unpaid on the shares.

Provisions with respect to Names of Companies

15.—(1) No company shall be registered by a name which in the opinion of the Registrar is undesirable having regard to such provisions as may be prescribed.

Registration of unlimited company as limited.

Prohibition of registration of companies by undesirable names.

11The Companies Act, 2004 [No. ]

(2) If, through inadvertence or otherwise, a company on its first registration or on its registration by a new name is registered by a name which in the opinion of the Registrar too closely resembles the name by whichacompanyinexistenceispreviouslyregistered, thefirstmentioned company may, with the sanction of the Registrar, change its name, and shall, if the Registrar so directs within six months of its being registered by that name, change its name within six weeks of the date of such direction or within such longer period as the Registrar may think fit to allow.

(3) If at any time after a company has been registered it appears to the Registrar that the name under which it is registered is undesirable, the Registrar may notify the company accordingly and may in such notification direct the company to change its name, and the company shall change its name within six weeks of such direction unless within that time it has lodged an appeal to the Court against such direction.

(4) The Court shall thereupon either cancel or confirm such direction and its decision shall be final and conclusive.

(5) If the direction is confirmed the company shall change its name within six weeks of such confirmation.

(6) If a company makes default in complying with a direction under subsection (2) or, except where an appeal has not been disposed of, under subsection (3), it shall be liable to a fine not exceeding one thousand dollars for every day during which the default continues.

(7) Subsections (3), (4) and (5) of section 17 shall apply to a change of name under this section as they apply to a change of name under that section.

16.—(1) Where it is proved to the satisfaction of the Minister that an association about to be formed as a limited company is to be formed for promoting commerce, art, science, religion, charity or any other useful object, and intends to apply its profits, if any, or other income in promoting its objects, and to prohibit the payment of any dividend to its members, the Minister may by licence direct that the association may be registered as a company with limited liability, without the addition of the word “limited” to its name, and the association may be registered

Power to dispense with "limited" in name of charitable and other companies.

[No. ] The Companies Act, 200412

accordinglyandshall,onregistrationenjoyall theprivilegesand(subject to the provisions of this section) be subject to all the obligations of limitedcompanies.

(2) Where it is proved to the satisfaction of the Minister—

(a) that the objects of a company registered under thisAct as a limited company or of an existing company, being a limited company, is restricted to the matters specified in subsection (1) and to objects incidental or conducive thereto; and

(b) that by its constitution the company is required to apply its profits, if any, or other income in promoting its objects and is prohibited from paying any dividend to its members,

the Minister may by licence authorize the company to make by special resolutionachange in itsnameincludingorconsistingof theomissionof the word “limited”, and subsections (4), (5) and (6) of section 17 shall apply to a change of name under this subsection as they apply to a change of name under that section.

(3) Alicence by the Minister under this section may be granted onsuchconditionsandsubject to such regulationsas the Minister thinks fit, and those conditions and regulations shall be binding on the body to which the licence is granted, and, where the grant is under subsection (1), shall, if the Minister so directs, be inserted in the articles.

(4) Abody to which a licence is granted under this section shall be exempted from the provisions of thisAct relating to the use of the word “limited” as any part of its name, the publishing of its name and the sending of lists of members to the Registrar.

(5) Alicence under this section may at any time be revoked by the Minister, and upon revocation the Registrar shall enter upon the register the word “limited” at the end of the name of the body to which it was granted, and the body shall cease to enjoy the exemptions and privilegesor, as thecasemaybe, theexemptionsgrantedby this section:

Provided that, before a licence is so revoked, the Minister shall give to the body notice in writing of his intention, and shall afford the body an opportunity of being heard in opposition to the revocation.

13The Companies Act, 2004 [No. ]

(6) Where a body in respect of which a licence under this section is in force alters the provisions of its articles with respect to its business, the Minister may (unless he sees fit to revoke the licence) vary the licence by making it subject to such conditions and regulations as the Ministerthinksfit, inlieuoforinadditiontotheconditionsandregulations, if any, to which the licence was formerly subject.

(7) Where a licence granted under this section to a body the nameofwhichcontains thewords“ChamberofCommerce” is revoked, the notice to be given under the proviso to subsection (5) shall include a statement of the effect of the provisions of subsection (2) of section 17.

(8) The procedure in cases of applications for licences under this sectionshallbe inaccordancewith that setout in theTenthSchedule.

17.—(1)Acompanymay,byspecial resolutionandwith theapproval of the Registrar signified in writing, change its name.

(2) Where a licence granted pursuant to section 16 to a body the name of which contains the words “Chamber of Commerce” is revoked, the body shall, within a period of six weeks from the date of the revocation or such longer period as the Registrar may think fit to allow, change its name to a name which does not contain those words.

(3) If such a body makes default in complying with the requirements of subsection (2), it shall be liable to a fine not exceeding two thousand dollars for every day during which the default continues.

(4) Where a company or a body changes its name under this section the Registrar shall enter the new name on the register in place of the former name, and shall issue a certificate of incorporation altered to meet the circumstances of the case.

(5) The change of name shall not affect any rights or obligations of the company or body, or render defective any legal proceedings by or against it, and any legal proceedings that might have been continued or commenced against it by its former name may be continued or commenced against it by its new name.

Tenth Schedule.

Change of Name.

[No. ] The Companies Act, 200414

(6) Where a company or body changes its name under this section it shall cause notice of the change of name to be published in the Gazette and in a daily newspaper printed and circulating in the Island within thirty days after the date on which the Registrar approves the change and if default is made in complying with this subsection the company or body and every director, manager, secretary or other officer of the company or body who knowingly and wilfully authorizes or permits the default shall be liable to a fine not exceeding fifty thousand dollars.

18. The Registrar may, upon request and upon payment of the prescribed fee, reserve for 90 days a name for an intended company or for a company about to change its name.

General Provisions with respect to Articles

19.—(1) Subject to the provisions of thisAct, the articles shall, when registered, bind the company and the members thereof to the same extent as if they respectively had been signed and sealed by each member,andcontainedcovenantson thepartofeachmember toobserve all the provisions of the articles.

(2)All money payable by any member to the company under the articles shall be a debt due from him to the company, and in this Island be of the nature of a specialty debt.

20.—(1) In the case of a company limited by guarantee and not havingasharecapital, everyprovision in thearticlesor inany resolution of the company purporting to give any person a right to participate in the divisible profits of the company otherwise than as a member shall be void unless such provision was in existence at the appointed day.

(2) For the purpose of the provisions of thisAct relating to the articles of a company limited by guarantee and of this section, every provision in the articles or in any resolution, of a company limited by guarantee purporting to divide the undertaking of the company into shares or interests shall be treated as a provision for a share capital notwithstanding that thenumberof thesharesor interests isnot specified thereby.

Reservation of name.

Effect of articles.

Provision as to articles of companies limited by guarantee.

15The Companies Act, 2004 [No. ]

21.Notwithstandinganythingin thearticlesofacompany,nomember of the company shall be bound by an alteration made in the articles after thedateonwhichhebecameamember, ifandsofaras thealteration requires him to take or subscribe for more shares than the number held byhimat thedateonwhichthealterationismade,or inanywayincreases his liabilityasat thatdate tocontribute to thesharecapitalof,orotherwise to pay money to, the company:

Providedthat thissectionshallnotapplyinanycasewherethemember agrees in writing, either before or after the alteration is made, to be bound thereby.

22.—(1) Acompany shall, on being so required by any member, send to him a copy of the articles, subject to payment of such sum as may be prescribed.

(2) If a company makes default in complying with this section, the company and every officer of the company who is in default shall be liable to a fine not exceeding two thousand dollars.

Membership of Company

23.—(1) The following persons are members of a company and shall be entered as members on its register of members—

(a) persons who subscribe to the company’s articles whose names shall, on the registration of the company, be entered in the company’s register;

(b) the personal representatives of a deceased member and the trustee in bankruptcy of a bankrupt member;

(c) persons named as a principal account holder or subsidiary account holder, as the case may be, during any period in respect of which eligible securities carrying voting rights are entered against their names in the register of the licensed central securities depository for that company's shares.".

(2) Every other person who agrees to become a member of a company, and whose name is entered in its register of members, shall be a member of the company.

(3) For the purposes of this section—

Alterations of articles increasing liability to contribute to share capital not to bind existing members without consent.

Copies of articles to be given to members.

Definition of member.

[No. ] The Companies Act, 200416

"licensedcentral securitiesdepository"meansacompany licensed under section 67B of the SecuritiesAct to operate a central securities depository;

"principal account holder" means a person who maintains an account with a licensed central securities depository;

"subsidiary account holder" means the person in whose name a subsidiaryaccount isopenedandmaintainedby theprincipal account holder.".

24.—(1) Except in the cases hereafter in this section mentioned, a body corporate cannot be a member of a company which is its holding company, and any allotment or transfer of shares in a company to its subsidiary shall be void.

(2) Nothing in this section shall apply where the subsidiary is concerned as personal representative, or where it is concerned as trustee,unless theholdingcompanyorasubsidiary thereof isbeneficially interested under the trust and is not so interested onlyby way of security for the purposes of a transaction entered into by it in the ordinary course of a business which includes the lending of money.

(3) This section shall not prevent—

(a) a subsidiary which is, on the appointed day, a member of its holding company; or

(b) a company which, being a member of another company, becomes a subsidiary of that company,

from continuing to be a member but, subject to subsection (2), the subsidiaryshallhavenoright tovoteatmeetingsof theholdingcompany or any class of members thereof.

(4) Subject to subsection (2), subsections (1) and (3) shall apply in relation to a nominee for a body corporate which is a subsidiary, as if references in subsections (1) and (3) to such a body corporate included references to a nominee for it.

(5) In relation to a company limited by guarantee or unlimited which is a holding company, the reference in this section to shares, whether or not it has a share capital, shall be construed as including a

Membership of holding company.

17The Companies Act, 2004 [No. ]

reference to the interest of its members as such, whatever the form of that interest.

Private Companies

25.—(1) For the purposes of this Act, the expression “private company” means a company which by its articles—

(a) restricts the right to transfer its shares; and

(b) limits the number of its members to twenty, not including persons who are in the employment of the company and personswho,havingbeen formerly in theemploymentof the companywere,while inthatemployment,andhavecontinued after the determination of that employment to be, members of the company; and

(c) prohibits any invitation to the public to subscribe for any shares or debentures of the company; and

(d) prohibits any invitation to the public to deposit money for fixed periods or payable on call whether bearing or not bearing interest; and

(e) subject to theexceptionsprovidedfor in theTwelfthSchedule, prohibits any person other than the holder from having any interest in any of the company’s shares.

(2) Where two or more persons hold one or more shares of a company jointly, they shall, for the purposes of this section, be treated as a single member.

(3) Subject to subsection (4), a private company shall not be obliged to file accounts unless, but shall be so obliged if, any of its shares is held by a body corporate, so, however, that any obligation to fileaccounts imposeduponaprivatecompanybyvirtueof thissubsection shallbesubject to theexceptionsprovidedfor in theThirteenthSchedule.

(4) In this Act the expression “file accounts” in relation to a company means to include in its annual return pursuant to subsection (3) of section 124 the documents and information mentioned in that subsection.

Twelfth Schedule.

Thirteenth Schedule.

Private companies.

[No. ] The Companies Act, 200418

(5) The provisions of paragraph (b) of subsection (1) shall not apply toacompanywhich is a foreignsalescorporationoperatingunder the Foreign Sales CorporationsAct.

(6) For the purposes of thisAct a public company is a company that is not a private company.

26.—(l) If a company, being a private company, alters its articles in such manner that they no longer include the provisions which, under section 25, are required to be included in the articles of a company in order to constitute it a private company, the company shall, as on the date of the alteration, cease to be a private company and shall, within a period of fourteen days after that date, deliver to the Registrar for registration a prospectus or a statement in lieu of prospectus in the form and containing the particulars set out in Part I of the Second Schedule and, in the cases mentioned in Part II of that Schedule, setting out the reports specified therein, and the said Parts I and II shall have effect subject to the provisions contained in Part III of that Schedule:

Provided that a statement in lieu of prospectus need not be delivered under this subsection if within the period of fourteen days aforesaid a prospectus relating to the company which complies with the Third Schedule is issuedand isdelivered to theRegistraras requiredbysection 40.

(2) Every statement in lieu of prospectus delivered under subsection (1) shall, where the persons making any such reports as aforesaid have made therein or have, without giving the reasons, indicated therein any such adjustments as are mentioned in paragraph 5 of Part III of the Second Schedule, have endorsed thereon or attached thereto a written statement signed by those persons setting out the adjustments and giving the reasons therefor.

(3) If default is made in complying with subsection (1) or (2) the company and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

(4) Where a statement in lieu of prospectus delivered to the Registrarundersubsection(1) includesanyuntruestatement, anyperson

Third Schedule.

Statement in lieu of prospectus to be delivered to Registrar by company ceasing to be private company.

Second Schedule.

19The Companies Act, 2004 [No. ]

who authorized the delivery of the statement in lieu of prospectus for registration shall be liable—

(a) onconvictiononindictment, to imprisonmentwithorwithout hard labour for a term not exceeding two years or a fine not exceeding fifty thousand dollars, or both such fine and imprisonment;or

(b) on summary conviction before a Resident Magistrate, to imprisonment with or without hard labour for a term not exceeding threemonthsora finenotexceedingfifty thousand dollars or both such fine and imprisonment,

unless he proves either that the untrue statement was immaterial or that he had reasonable ground to believe and did up to the time of the delivery for registration of the statement in lieu of prospectus believe that the untrue statement was true.

(5) For the purposes of this section—

(a) a statement included in a statement in lieu of prospectus shall be deemed to be untrue if it is misleading in the form and context in which it is included; and

(b) a statement shall be deemed to be included in a statement in lieu of prospectus if it is contained therein or in any report or memorandum appearing on the face thereof or by reference incorporated therein.

27. Where the articles of a company include the provisions which under section 25 are required to be included in the articles of a company in order to constitute it a private company but default is made in complying with any of those provisions, the company shall cease to be entitled to theprivilegesandexemptionsconferredonprivatecompanies under the provisions contained in subsection (3) of that section, and thereupon those provisions shall apply to the company as if it were not a private company:

Provided that the Court, on being satisfied that the failure to comply with the conditions was accidental or due to inadvertence or to some other sufficient cause, or that on other grounds it is just and equitable to grant relief, may on the application of the company or any other person

Consequences of default in complying with conditions constituting company a private company.

[No. ] The Companies Act, 200420

interested and on such terms and conditions as may seem to the Court just and expedient, order that the company be relieved from such consequences as aforesaid.

Mutual Fund Companies

27A.—(1) A"mutual fund company" means a company having a share capital and incorporated for the purpose of investing the moneys of its members for their mutual benefit, stating in its articles that it is a mutual fund, having the power to redeem or purchase for cancellation its shares without reducing its authorized share capital and is registered under the SecuritiesAct as a mututal fund.

(2)Amutual fund company may, on the redemption of its own shares, repay the capital paid up on such shares out of its stated capital account or reserves, on such terms and in such manner and at such price as may be determined having regard to the asset values of shares as ascertained in accordance with the articles of the company.

(3) The redemption or purchase of its own shares by a mutual fundcompanyshallnotbe takenas reducing its authorizedsharecapital, andamutual fundshallhave thepower to issuesharesequal inaggregate value to the aggregate value of the shares so redeemed or purchased as if those shares had never been issued and the issuance of such shares under the power herein contained shall not be taken as increasing the amount of its issued share capital.

(4) The powers of a mutual fund company referred to in subsection (3) shall be exercisable by the directors of the mutual fund company or in accordance with the policies and procedures established by the directors.

(5) No shares of a mutual fund company shall be redeemed by themutual fundcompanyorpurchasedbyanothermutual fundcompany unless such shares are fully paid.

(6) Amutual fundcompanyshallbeexempt fromtheprovisions of sections 41, 42, 43, and 46 of this Act in relation to a prospectus and the offering of shares for sale or subscription to the public; and sections 44, 45 and 47 of thisAct and the provisions of the Securities

Mutual Fund Company.

21The Companies Act, 2004 [No. ]

Act shall apply to such comapny in relation to a prospectus and the offering of shares for sale or subscription to the public.

(7) Sections 112 and 113 of thisAct (inspection of register of members by public) shall not apply to a mutual fund company."

Contracts, etc.

28.—(1) Contracts on behalf of a company may be made as follows—

(a) a contract which if made between private persons would be by law required to be in writing and if made according to the law of Jamaica to be under seal, may be made on behalf of the company in writing under the common seal of the company;

(b) a contract which if made between private persons would be by law required to be in writing, signed by the parties to be charged therewith may be made on behalf of the company in writingsignedbyanypersonactingunder itsauthorityexpress or implied;

(c) a contract which if made between private persons would by law be valid although made by parol only, and not reduced intowriting,maybemadebyparolonbehalfof thecompany by any person acting under its authority, express or implied.

(2) Acontract made according to this section shall be effectual in law, and shall bind the company and its successors and all other parties thereto.

(3)Acontract made according to this section may be varied or discharged in the same manner in which it is authorized by this section to be made.

29.—(1) Except as provided in this section, a person who enters into an oral or written agreement or contract in the name of or on behalf of a company before it comes into existence or who purports to enter intosuchanagreementorcontract, ispersonallyboundbytheagreement or contract and is entitled to the benefits of that agreement or contract.

Pre- incorporation contracts.

Form of contracts.

[No. ] The Companies Act, 200422

(2) Within a reasonable time after a company comes into existence, it may, by any action or conduct signifying its intention to be bound thereby, adopt an oral or written agreement or contract made in its name or on its behalf before it came into existence.

(3) When a company adopts an agreement or contract under subsection (2)—

(a) the company is bound by the agreement or contract and is entitled to the benefits thereof as if the company had been in existence at the date of the contract and had been a party to it; and

(b) a person who purported to act in the name of the company or on its behalf ceases, except as provided in subsection (4), tobeboundbyorentitled to thebenefitsof theagreement or contract.

(4) Except as provided in subsection (5), whether or not an oral or written agreement or contract made before the company came into existence is adopted by the company, a party to the agreement or contract may apply to the court for an order—

(a) fixing obligations under the contract as joint or joint and several; or

(b) apportioning liability between or among the company and a person who purported to act in the name of the company or on its behalf,

and the court may, upon the application, make any order it thinks fit.

(5) If expresslysoprovided inanagreementorcontract, aperson who purported to act for or on behalf of a company before it came into existence is not in any event bound by the agreement or contract or entitled to the benefits thereof.

30. Abill of exchange or promissory note shall be deemed to have been made, accepted or indorsed on behalf of a company if made, accepted or endorsed in the name of, or by or on behalf or on account of, the company by any person acting under its authority.

Bills of exchange and promissory notes.

23The Companies Act, 2004 [No. ]

31.—(1) A company may, by writing under its common seal, empower any person, either generally or in respect of any specified matters, as its attorney, to execute deeds on its behalf in any place not situated in the Island.

(2)Adeed signed by such an attorney on behalf of the company and under his seal shall bind the company and have the same effect as if it were under its common seal.

32.—(1) A company whose business requires or comprises the transactionof businessoutof the Islandmay, if authorizedby itsarticles, have for use in any territory, district, or place not situated in the Island, an official seal, which shall be a facsimile of the common seal of the company, with the addition on its face of the name of every territory, district or place where it is to be used.

(2)Adeed or other document to which an official seal is duly affixed shall bind the company as if it had been sealed with the common seal of the company.

(3)Acompanyhavinganofficial seal foruse inanysuchterritory, district or place may, by writing under its common seal, authorize any person appointed for the purpose in that territory, district or place to affix theofficialseal toanydeedorotherdocument towhichthecompany is party in that territory, district or place.

(4) The authority of any such agent shall, as between the company and any person dealing with the agent, continue during the period, if any, mentioned in the instrument conferring the authority, or if no period is so mentioned, then until notice of the revocation or determination of the agent’s authority has been given to the person dealingwithhim.

(5) The person affixing any such official seal shall, by writing under his hand, certify on the deed or other instrument to which the seal is affixed, the date on which and the place at which it is affixed.

Authentication of Documents

33. Adocumentorproceedingrequiringauthenticationbyacompany may be signed by a director, secretary or other authorized officer of the company, and need not be under its common seal.

Authentication of documents.

Execution of deeds abroad.

Company may have official seal for use abroad.

[No. ] The Companies Act, 200424

PART II—Share Capital and Debentures

34.—(1)Acompany registered as a public company having a share capital on its original incorporation shall not do business or exercise anyborrowingpowersunless theRegistrarhas issued itwithacertificate under this section or the company is re-registered as a private company.

(2) The Registrar shall issue a company with such a certificate if,onanapplicationbythecompanyin theprescribedform,he issatisfied that the value of the company’s allotted share capital is not less than the authorized minimum, and there is delivered to the Registrar a statutory declaration in accordance with subsection (3).

(3) The statutory declaration shall be in the prescribed form and be signed by a director or secretary of the company and shall—

(a) state that the value of the company’s allotted share capital is not less than the authorized minimum;

(b) specify the amount paid up, at the time of the application, on the company’s allotted share capital;

(c) specify the amount, or estimated amount, of the company’s preliminary expenses and the persons by whom any of those expenses have been paid or are payable; and

(d) specify the amount or benefit paid or given, or intended to be paid or given, to any promoter of the company, and the consideration for the payment or benefit.

35.—(1) In section 34 “authorized minimum” means five hundred thousand dollars or such other sum as the Minister may, by order, prescribe.

(2)Anorderunder subsection (1)which increases theauthorized minimummay—

(a) require any public company having an allotted share capital of which the value is less than the amount specified in the order as the authorized minimum to increase that value to not less than that amount or make application to be re- registered as a private company;

Minimum share capital.

Authorized minimum.

25The Companies Act, 2004 [No. ]

(b) make, in connection with any such requirement, provision for any of the matters for which provision is made by this Act relating to—

(i) a company’s registration, re-registration or change of name;

(ii) payment for any share comprised in a company’s capital and offers of shares in or debentures of a company to the public, including provision as to the consequences (whether in criminal law or otherwise) of a failure to comply with any requirement of the order; and

(c) contain such supplemental and transitional provisions as the Minister thinks appropriate, make different provisions for different cases and in particular, provide for any provision of theorder tocomeintooperationondifferentdaysfordifferent purposes.

(3)An order under this section shall be subject to affirmative resolution.

36. Subject to section 37—

(a) from the appointed day shares in a company shall be issued without nominal or par value;

(b) a share with a nominal or par value issued before the appointeddayshall bedeemed tobeasharewithoutnominal or par value.

37.—(1) Anexistingcompanymaybyordinary resolutionwithinsix monthsof theappointedday, electunder this section to retain its existing shares with a nominal or par value and may continue to issue shares with a nominal or par value.

(2) Anexistingcompanywhichfails tomakeanelectionpursuant to subsection (1) , shall be deemed to have converted at the end of the six months period referred to in that subsection, its existing shares to shares without nominal or par value and any shares issued thereafter shall be issued without a nominal or par value.

Nature of shares.

Election to retain par value shares.

[No. ] The Companies Act, 200426

(3) An existing company which makes an election pursuant to subsection (1) shall serve the Registrar with notice of that Resolution.

(4) Where an existing company makes an election pursuant to subsection (1)—

(a) the provisions of the repealed Act specified in subsection (5) shall, to the extent that they are relevant to the shares having a nominal or par value (and to that extent only), continue to apply to that company; and

(b) the provisions of thisAct which provide for a determination of the value of shares without reference to a nominal or par value shall not apply to that company.

(5) The provisions of the repealedAct mentioned in subsection (4) (a) are as follows—

Section 56 (Application of premiums received on issue of shares);

Section 57 (Power to issue redeemable preference shares);

Section 58 (Power to issue shares at a discount);

Section 64 (Power of unlimited company to provide for reserve share capital on registration);

Section 66 (Special resolution for reduction of share capital);

Section 67 (Application to Court for confirming order objections by creditors, and settlement of list of objecting creditors);

Section 68 (Order confirming reduction and powers of Court on making such order);

Section 69 (Registration of order and minute of reduction);

TABLE A

Paragraph 11 (First and paramount lien);

Paragraphs 15—21 (Calls on shares).

(6) Where an existing company has made an election pursuant to subsection (1), that company shall at the end of eighteen months from the date of the election, be deemed to have converted its existing

27The Companies Act, 2004 [No. ]

shares to shares without a nominal or par value and any shares issued thereafter shall be shares issued without a nominal or par value.

38.—(1) Ashare may be paid for—

(a) in money; or

(b) in property or past service rendered for value that is the fair equivalent of the money that the company would have received if the share had been issued for money.

(2) In determining whether property or past service is the fair equivalent of money consideration, the directors may take into account reasonable charges and expenses of organization and reorganization, and payments for property and past services reasonably expected to benefit the company.

(3) For the purposes of this section “property” does not include a debt security other than—

(a) a debt security of a company as part of a merger, acquisition, amalgamation or scheme of arrangement, reorganization or reconstruction.

(b) promises to pay that are comprised of government securities or debt instruments that are guaranteed by a financial institution.

(4) Subject to this section, no allotment by a company of shares for a consideration other than cash shall be made unless—

(a) the directors of the company have passed a resolution that the allotment be made; and

(b) the resolution states the nature of the consideration, its value and the extent to which the shares to be issued in respect of it will be credited as paid up by virtue of it;

(5) Before passing a resolution pursuant to subsection (4) (a), the directors of the company shall—

(a) where theconsiderationconsistsof services, haveaqualified accountant estimate the value of the services to the company in money terms; or

Consideration.

[No. ] The Companies Act, 200428

(b) inanyothercase,have theconsiderationvaluedbyaqualified accountant, valuer or surveyor.

(6) No allotment as aforesaid shall be made unless, not more than one hundred and twenty days before the allotment, the accountant, or as the case may be, valuer or surveyor reports that in his opinion the value of the services to the company in money terms or the value of the other consideration in question is worth at least as much as the amount which will be credited as paid up on the shares to be allocated in respect of those services or that consideration.

(7) Where, pursuant to a pre-incorporation arrangement, consideration other than cash is made for any allotment, the nature and value of that consideration shall be stated in the company’s articles and the allotment shall be approved by a general meeting of the company.

(8) In subsection (3) (b)—

“financial institution”means—

(a) acompany licensedunder theBankingAct, theFinancial InstitutionsAct or the SecuritiesAct; or

(b) a society registered under the Co-operative Societies Act or incorporated under the Building SocietiesAct;

"Government securities" include securities by a body corporate that is owned or controlled by the Government.

39.—(1)A company shall maintain a separate stated capital account for each class and series of shares issued by it.

(2) A company shall add to the appropriate stated capital account, the full amount of the consideration received by it for any shares issued by the company.

(3) A company shall not reduce its stated capital or any stated capital account except in the manner provided by thisAct.

(4) A company shall not, in respect of a share issued by it, add to a stated capital account, an amount greater than the amount of the consideration received by the company for the share.

(5) When a company proposes to add an amount to a stated capital account maintained by it in respect of a class or series of shares,

Stated capital accounts.

29The Companies Act, 2004 [No. ]

that addition to the stated capital account shall be approved by special resolution if—

(a) bonus shares are not being apportioned rateably among all shareholders; and

(b) the effect of the bonus issue on voting rights is such that the holdersofoneclassof sharesassumecontrolof thecompany or are able to pass a resolution which, prior to the bonus issue, they did not have sufficient voting rights to carry if the other shareholders were against it.

(6) Notwithstanding section 38 and subsection (2) of this section—

(a) when, in exchange for property, a company issues shares—

(i) to a body corporate that was an affiliate of the company immediately before the exchange; or

(ii) to a person who controlled the company immediately before the exchange,

the company, subject to subsection (4), may add to the stated capital accounts that are maintained for the shares of the classes or series issued, the amount agreed, by the company and the body corporate or person, to be the consideration for the shares so exchanged;

(b) when a company issues shares in exchange for shares of a body corporate referred to in paragraph (a) (i) the company may, subject to subsection (4), add to the stated capital accounts maintained for the shares of the classes or series issued, the whole or any part of the consideration it received in exchange; or

(c) when a company issues shares in exchange for shares of a bodycorporate thatbecomes thecompany’saffiliatebecause of the exchange, the company may, subject to subsection (4), add to the stated capital accounts that are maintained for the classes or series issued, an amount that is not less than the amount set out, in respect of the acquired shares of

[No. ] The Companies Act, 200430

the body corporate, in the stated capital or equivalent accounts of the body corporate immediately before the exchange.

(7) When a company which was incorporated before the appointeddaycontinues inexistenceafter thatdate then,notwithstanding subsection (2), it is not required to add to a stated capital account, any consideration received by it before that date, unless the shares in respect of which the consideration is received are issued after that date.

Prospectus

40.—(1) A prospectus issued by or on behalf of a company or in relation to an intended company shall be dated.

(2) No prospectus shall be issued by or on behalf of a company or in relation toan intendedcompanyunlessbefore thedateof its issue—

(a) there has been delivered to the Registrar for the purpose of securing registration of the prospectus a copy thereof signed by every person who is named therein as director or proposed director of the company or by his agent authorized inwriting;and

(b) pursuant thereto registration has been effected.

(3) Every prospectus shall state on the face of it that the prospectus has been registered as required by subsection (2).

(4) The Registrar shall not register any prospectus unless it is dated, and the copy thereof signed, in manner required by this section, and he may refuse to register a prospectus if—

(a) in any case where he considers that on the face of it the prospectus ismisleading,within fourteendaysof thedelivery of the copy of the prospectus (or such longer period as may be prescribed) he by notice in writing informs the company or any other person who has delivered the copy of the prospectus pursuant to this section that in his opinion the prospectus is misleading for the reasons stated in the notice; or

Dating and registration of prospectus.

31The Companies Act, 2004 [No. ]

(b) in any case where he considers it necessary or expedient for himtocarryoutan investigationas towhether theprospectus is misleading, he by notice in writing—

(i) within fourteendaysof thedeliveryof thecopyof the prospectus (or such longer period as may be prescribed) so informs the company or any other person as aforesaid; and

(ii) within six weeks of the delivery of the copy of the prospectus (or such longer period as may be prescribed) informs the company or any other person as aforesaid that in his opinion the prospectus is misleading for the reasons stated in the notice.

(5) In any case where the Registrar acting under the power given by paragraph (a) or (b) of subsection (4) refuses to register a prospectus, the company or any other person who has delivered the copy of the prospectus pursuant to this section may apply to the Court, which, after hearing the applicant and the Registrar, and such evidence as theymaycall,mayeitherorder theRegistrar to register theprospectus or may dismiss the application.

(6) Whenever the Registrar has registered a prospectus under this section he shall in writing inform the company or any other person who has delivered the copy of the prospectus pursuant to this section of the fact of registration and the date thereof, and every prospectus issued by or on behalf of a company or in relation to an intended company shall show on its face, in addition to the date required by subsection (1), the date of registration.

(7) If a prospectus is issued without having been registered as requiredbythissection, thecompany,andeverypersonwhoisknowingly a party to the issue of the prospectus, shall be liable to a fine not exceeding five thousand dollars for every day from the date of the issue of the prospectus until it is withdrawn in a manner which either is reasonable having regard to all the circumstances of the case or accords with the reasonable directions of the Registrar.

[No. ] The Companies Act, 200432

41.—(1) Every prospectus issued by or on behalf of a company, or by or on behalf of any person who is or has been engaged or interested in the formation of the company, must state the matters specified in Part I of the Third Schedule and set out the reports specified in Part II of that Schedule.

(2)Acondition requiring or binding an applicant for shares in or debentures of a company to waive compliance with any requirement of this section, or purporting to affect him with notice of any contract, document, or matter not specifically referred to in the prospectus shall be void.

(3) It shall not be lawful to issue any form of application for shares in or debentures of a company unless the form is issued with a prospectus which complies with the requirements of this section:

Provided that this subsection shall not apply if it is shown that the form of application was issued either—

(a) in connection with a bona fide invitation to a person to enter in to an underwriting agreement with respect to the shares or debentures; or

(b) in relation to shares or debentures which were not offered to the public.

(4) If any person acts in contravention of the provisions of subsection (3), he shall be liable to a fine not exceeding five thousand dollars for every day during which the contravention continues.

(5) In the event of non-compliance with or contravention of any of the requirements of this section a director or other person responsible for the prospectus shall not incur any liability by reason of the non- compliance or contravention, if—

(a) as regards any matter not disclosed, he proves that he was not cognizant thereof; or

(b) he proves that the non-compliance or contravention arose from an honest mistake of fact on his part; or

(c) thenon-complianceorcontraventionwasinrespectofmatters which in the opinion of the Court dealing with the case were

Specific requirements as to particulars in prospectus. Third Schedule.

33The Companies Act, 2004 [No. ]

immaterial or was otherwise such as ought, in the opinion of that Court, having regard to all the circumstances of the case, reasonably to be excused:

Provided that, in the event of failure to include in a prospectus a statement with respect to the matters specified in paragraph 16 of the Third Schedule, no director or other person shall incur any liability in respect of the failure unless it be proved that he had knowledge of the matters not disclosed.

(6) This section shall not apply to the issue, to existing members or debenture holders of a company, of a prospectus or form of application relating to shares in or debentures of the company, whether an applicant for shares or debentures will or will not have the right to renounce in favourofotherpersons,but subject asaforesaid, this section shall apply to a prospectus or a form of application whether issued on or with reference to the formation of a company or subsequently.

(7) Nothing in this section shall limit or diminish any liability which any person may incur under the general law or this Act apart from this section.

42.—(1)Aprospectus inviting persons to subscribe for shares in or debentures of a company and including a statement purporting to be made by an expert shall not be issued unless—

(a) he has given and has not, before delivery of a copy of the prospectus for registration, withdrawn his written consent to the issue thereof with the statement included in the form and context in which it is included; and

(b) a statement that he has given and has not withdrawn his consent as aforesaid appears in the prospectus.

(2) If any prospectus is issued in contravention of this section, the company and every person who is knowingly a party to the issue thereof shall be liable to a fine not exceeding one hundred thousand dollars.

(3) In this section the expression “expert” includes engineer, valuer, accountant and any other person whose profession gives authority to a statement made by him.

Third Schedule.

Expert's consent to issue of prospectus containing statement by him.

[No. ] The Companies Act, 200434

43.—(1) A company limited by shares or a company limited by guarantee and having a share capital shall not, prior to the statutory meeting, vary the terms of a contract referred to in the prospectus, or statement in lieu of prospectus, except subject to the approval of the statutorymeeting.

(2) This section shall not apply to a private company.

(3) If default is made in complying with the provisions of subsection (1), the company and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

44.—(1) Subject to the provisions of this section, where a prospectus invites persons to subscribe for shares in or debentures of a company, the following persons shall be liable to pay compensation to all persons whosubscribe foranysharesordebentureson the faithof theprospectus for the loss or damage they may have sustained by reason of any untrue statement included therein, that is to say—

(a) every person who is a director of the company at the time of the issue of the prospectus;

(b) every person who has authorized himself to be named and is named in the prospectus as a director or as having agreed to become a director either immediately or after an interval of time;

(c) every person who is a promoter of the company; and

(d) every person who has authorized the issue of the prospectus:

Provided that where, under section 42, the consent of a person is required to the issue of a prospectus and he has given that consent, he shall not by reason of his having given it be liable under this subsection as a person who has authorized the issue of the prospectus except in respect of an untrue statement purporting to be made by him as an expert.

(2) No person shall be liable under subsection (1) if he proves—

(a) that, having consented to become a director of the company, he withdrew his consent before the issue of the prospectus, and that it was issued without his authority or consent; or

Restriction on alternation of terms mentioned in prospectus or statement in lieu of prospectus.

Civil liability for statements in prospectus.

35The Companies Act, 2004 [No. ]

(b) that the prospectus was issued without his knowledge or consent, and thatonbecomingawareof its issuehe forthwith gave reasonable public notice that it was issued without his knowledge or consent; or

(c) that, after the issue of the prospectus and before allotment thereunder, he, on becoming aware of any untrue statement therein, withdrew his consent thereto and gave reasonable public notice of the withdrawal and of the reason therefor; or

(d) that—

(i) as regards every untrue statement not purporting to be made on the authority of an expert or of a public official document or statement, he had reasonable ground to believe, and did up to the time of the allotment of the shares or debentures, as the case may be, believe, that the statement was true; and

(ii) as regards every untrue statement purporting to be a statement by an expert or contained in what purports to be a copy of or extract from a report or valuation of an expert, it fairly represented the statement, or was a correct and fair copy of or extract from the report or valuation, and he had reasonable ground to believe and did up to the time of the issue of the prospectus believe that the person making the statement was competent to make it and that person had given the consent required by section 42 to the issue of the prospectus and had not withdrawn that consent before delivery of a copy of the prospectus for registration or, to the defendant’s knowledge, before allotment thereunder; and

(iii) as regards every untrue statement purporting to be a statement made by an official person or

[No. ] The Companies Act, 200436

contained in what purports to be a copy of or extract from a public official document, it was a correct and fair representation of the statement or copy of or extract from the document:

Provided that this subsection shall not apply in the case of a person liable,byreasonofhishavinggivenaconsent requiredof himbysection 42, as a person who has authorized the issue of the prospectus in respect of an untrue statement purporting to be made by him as an expert.

(3) A person who, apart from this subsection, would under subsection (1)be liable,by reasonofhishavinggivenaconsent required of him by section 42, as a person who has authorized the issue of a prospectus in respect of an untrue statement purporting to be made by him as an expert shall not be so liable if he proves—

(a) that, having given his consent under that section to the issue of the prospectus, he withdrew it in writing before delivery of a copy of the prospectus for registration; or

(b) that, afterdeliveryofacopyof theprospectus for registration and before allotment thereunder, he, on becoming aware of the untrue statement, withdrew his consent in writing and gave reasonable public notice of the withdrawal, and of the reason therefor; or

(c) that he was competent to make the statement and that he had reasonable ground to believe and did up to the time of the allotment of the shares or debentures, as the case may be, believe that the statement was true.

(4) Where—

(a) the prospectus contains the name of a person as a director of the company, or as having agreed to become a director thereof, and he has not consented to become a director, or has withdrawn his consent before the issue of the prospectus, and has not authorized or consented to the issue thereof; or

(b) the consent of a person is required under section 42 to the issue of the prospectus and he either has not given that

37The Companies Act, 2004 [No. ]

consent or has withdrawn it before the issue of the prospectus,

the directors of the company, except and without whose knowledge or consent theprospectuswas issued, andanyotherpersonwhoauthorized theissuethereofshallbeliabletoindemnifythepersonnamedasaforesaid or whose consent was required as aforesaid, as the case may be, against all damages, costs and expenses to which he may be made liable by reason of his name having been inserted in the prospectus or of the inclusion therein of a statement purporting to be made by him as an expert, as the case may be, or in defending himself against any action or legal proceeding brought against him in respect thereof:

Provided that a person shall not be deemed for the purposes of this subsection to have authorized the issue of a prospectus by reason only of his having given the consent required by section 42 to the inclusion therein of a statement purporting to be made by him as an expert.

(5) For the purposes of this section—

(a) “expert” has the same meaning as in section 42; and

(b) “promoter” means a promoter who was a party to the preparation of the prospectus, or of the portion thereof containing the untrue statement, but does not include any person by reason of his acting in a professional capacity for persons engaged in procuring the formation of the company.

45.—(1) Where a prospectus issued after the appointed day includes any untrue statement, any person who authorized the issue of the prospectus shall be liable—

(a) onconvictiononindictment, to imprisonmentwithorwithout hard labour for a term not exceeding two years, or a fine or both such imprisonment and fine; or

(b) on summary conviction before a Resident Magistrate, to imprisonment with or without hard labour for a term not exceeding threemonths,or a finenot exceedingonehundred thousand dollars, or both such imprisonment and fine,

Criminal liability for misstatements in prospectus.

[No. ] The Companies Act, 200438

unless he proves either that the statement was immaterial or that he had reasonable ground to believe and did, up to the time of the issue of the prospectus, believe that the statement was true.

(2)A person shall not be deemed for the purposes of this section to have authorized the issue of a prospectus by reason only of his having given the consent required by section 42 to the inclusion therein of a statement purporting to be made by him as an expert.

46.—(1) Where a company allots or agrees to allot any shares in or debentures of the company with a view to all or any of those shares or debentures being offered for sale to the public—

(a) any document by which the offer for sale to the public is made shall for all purposes be deemed to be a prospectus issued by the company; and

(b) all enactments and rules of law as to the contents of prospectuses and to liability in respect of statements in and omissions from prospectuses, or otherwise relating to prospectuses,

shall apply and have effect accordingly, as if the shares or debentures hadbeenoffered to thepublic forsubscriptionandas ifpersonsaccepting the offer in respect of any shares or debentures were subscribers for those shares or debentures, but without prejudice to the liability, if any, of the persons by whom the offer is made, in respect of misstatements contained in the document or otherwise in respect thereof.

(2) For the purposes of thisAct, it shall, unless the contrary is proved, be evidence that an allotment of, or an agreement to allot, shares or debentures was made with a view to the shares or debentures being offered for sale to the public if it is shown—

(a) that an offer of the shares or debentures or of any of them for sale to the public was made within six months after the allotment or agreement to allot; or

(b) that at the date when the offer was made the whole consideration to be received by the company in respect of the shares or debentures had not been so received.

Document containing offer of shares or debentures for sale to be deemed prospectus.

39The Companies Act, 2004 [No. ]

(3) Section 40 as applied by this section shall have effect as though thepersonsmaking theofferwerepersonsnamedinaprospectus as directors of a company, and section 41 as applied by this section shall have effect as if it required a prospectus to state in addition to the matters required by that section to be stated in a prospectus—

(a) thenetamountof theconsideration receivedor tobereceived by the company in respect of the shares or debentures to which the offer relates; and

(b) the place and time at which the contract under which those shares or debentures have been or are to be allotted may be inspected.

(4) Where a person making an offer to which this section relates is a company or a firm, it shall be sufficient if the document aforesaid is signedonbehalfof thecompanyor firmbytwodirectorsof thecompany or not less than half of the partners, as the case may be, and any such director or partner may sign by his agent authorized in writing.

47. For the purposes of the foregoing provisions of this Part—

(a) a statement included in a prospectus shall be deemed to be untrue if it is misleading in the form and context in which it is included; and

(b) a statement shall be deemed to be included in a prospectus if it is contained therein or in any report or memorandum appearing on the face thereof or by reference incorporated therein or issued therewith.

Allotment

48.—(1) No allotment shall be made of any share capital of a company offered to the public for subscription unless the amount stated in the prospectus as the minimum amount which, in the opinion of the directors must be raised by the issue of share capital in order to provide for the matters specified in paragraph 4 of the Third Schedule has been subscribed, and the sum payable on application for the amount so stated has been paid to and received by the company.

(2) For the purposes of subsection (1), a sum shall be deemed to have been paid to and received by the company if a cheque for that

Interpretation of provisions relating to prospectuses.

Prohibition of allotment unless minimum subscription received.

Third Schedule.

[No. ] The Companies Act, 200440

sum has been received in good faith by the company and the directors of the company have no reason for suspecting that the cheque will not be paid.

(3) The amount so stated in the prospectus shall be reckoned exclusively of any amount payable otherwise than in cash and is in this Act referred to as “the minimum subscription”.

(4) If the conditions aforesaid have not been complied with on the expiration of forty days after the first issue of the prospectus, all money received from applicants for shares shall be forthwith repaid to them without interest, and, if any such money is not so repaid within forty-eight days after the issue of the prospectus, the directors of the company shall be jointly and severally liable to repay that money with interest at the rate of six per centum per annum from the expiration of the forty-eighth day:

Provided that a director shall not be liable if he proves that the default in the repayment of the money was not due to any misconduct or negligence on his part.

(5)Any condition requiring or binding any applicant for shares to waive compliance with any requirement of this section shall be void.

(6) This section shall not apply to any allotment of shares subsequent to the first allotment of shares offered to the public for subscription.

49.—(1)Acompany having a share capital which does not issue a prospectus on or with reference to its formation, or which has issued such a prospectus but has not proceeded to allot any of the shares offered to the public for subscription, shall not allot any of its shares or debentures unless at least three days before the first allotment of either shares or debentures there has been delivered to the Registrar for registration a statement in lieu of prospectus, signed by every person who is named therein as a director or a proposed director of the companyorbyhisagentauthorizedinwriting, in theformandcontaining the particulars set out in Part I of the Fourth Schedule and, in the cases mentioned in Part II of that Schedule, setting out the reports specified therein, and those Parts shall have effect subject to the provisions contained in Part III of that Schedule.

Prohibition of allotment in certain cases unless statement in lieu of prospectus delivered to Registrar.

Fourth Schedule.

41The Companies Act, 2004 [No. ]

(2) Every statement in lieu of prospectus delivered under subsection (1) shall, where the persons making any such report as aforesaid have made therein or have, without giving the reasons, indicated therein any such adjustments as are mentioned in paragraph 5 of the Fourth Schedule, have endorsed thereon or attached thereto a written statement signed by those persons setting out the adjustments and giving the reasons therefor.

(3) This section shall not apply to a private company.

(4) If a company acts in contravention of subsection (1) or (2), the company and every director of the company who knowingly authorizes or permits the contravention shall be liable to a fine not exceeding fifty thousand dollars.

(5) Where a statement in lieu of prospectus delivered to the Registrarundersubsection(1) includesanyuntruestatement, anyperson who authorized the delivery of the statement in lieu of prospectus for registration shall be liable—

(a) onconvictiononindictment, to imprisonmentwithorwithout hard labour for a term not exceeding two years or a fine or both such imprisonment and fine; or

(b) on summary conviction before a Resident Magistrate, to imprisonment with or without hard labour for a term not exceeding three months or a fine not exceeding one hundred thousand dollars, or both such imprisonment and fine,

unless he proves either that the untrue statement was immaterial or that he had reasonable ground to believe and did up to the time of the delivery for registration of the statement in lieu of prospectus believe that the untrue statement was true.

(6) For the purposes of this section—

(a) a statement included in a statement in lieu of prospectus shall be deemed to be untrue if it is misleading in the form and context in which it is included; and

(b) a statement shall be deemed to be included in a statement in lieu of prospectus if it is contained therein or in any report or

[No. ] The Companies Act, 200442

memorandum appearing on the face thereof or by reference incorporated therein.

50.—(1) An allotment made by a company to an applicant in contravention of the provisions of sections 48 and 49 shall be voidable at the instance of the applicant within one month after the holding of the statutory meeting of the company and not later, or, in any case where the company is not required to hold a statutory meeting, or where the allotment is made after the holding of the statutory meeting, within one month after the date of the allotment, and not later, and shall be so voidablenotwithstanding that thecompany is incourseof beingwound up.

(2) If any director of a company knowingly contravenes, or permits or authorizes the contravention of, any of the provisions of sections 48 and 49 with respect to allotment, he shall be liable to compensate the company and the allottee respectively for any loss, damages,orcostswhich thecompanyor theallotteemayhavesustained or incurred thereby:

Provided that proceedings to recover any such loss, damages or costs shall not be commenced after the expiration of two years from the date of the allotment.

51.—(1) No allotment shall be made of any shares in or debentures of a company in pursuance of a prospectus issued generally and no proceedings shall be taken on applications made in pursuance of a prospectus so issued, until the beginning of the third day after that on which the prospectus is first so issued or such later time (if any) as may be specified in the prospectus.

(2) The beginning of the third day or such later time as aforesaid is hereafter in this Act referred to as “the time of the opening of the subscription lists”.

(3) In subsection (1) the reference to the day on which the prospectus is first issued generally shall be construed as referring to the day on which it is first so issued as a newspaper advertisement:

Provided that, if it is not so issued as a newspaper advertisement before the third day after that on which it is first so issued in any other

Effect of irregular allotment.

Applications for, and allotment of shares and debenture.

43The Companies Act, 2004 [No. ]

manner, the reference shall be construed as referring to the day on which it is first so issued in any manner.

(4) The validity of an allotment shall not be affected by any contraventionof the foregoingprovisionsof this sectionbut, in theevent ofanysuchcontravention, thecompanyandeveryofficerof thecompany who is in default shall be liable to a fine not exceeding fifty thousand dollars.

(5) In the application of this section to a prospectus offering shares or debentures for sale, subsections (1), (3) and (4) shall have effect with the substitution of references to sale for references to allotment, and with the substitution for the reference to the company and every officer of the company who is in default of a reference to any person by or through whom the offer is made and who knowingly and wilfully authorizes or permits the contravention.

(6) An application for shares in or debentures of a company which is made in pursuance of a prospectus issued generally shall not be revocable until after the expiration of the third day after the time of the opening of the subscription lists, or the giving before the expiration of that third day, by some person responsible under section 44 for the prospectus, of a public notice having the effect under that section of excludingor limiting the responsibilityof thepersongiving it.

52.—(1)Wheneveracompanylimitedbysharesoracompanylimited by guarantee and having a share capital makes any allotment of its shares, the company shall within one month thereafter deliver to the Registrar for registration—

(a) a return of the allotments stating the number of shares comprised in the allotment, the names, addresses and descriptions of the allottees, and the amount, if any, paid or due and payable on each share; and

(b) in the case of shares allotted as fully or partly paid up otherwise than in cash, a contract in writing constituting the title of the allottee to the allotment together with any contract of sale, or for services or other consideration in respect of which that allotment was made, such contracts being duly

Return as to allotments.

[No. ] The Companies Act, 200444

stamped,andareturnstating thenumberofsharessoallotted, the extent to which they are to be treated as paid up, and the consideration for which they have been allotted.

(2)Wheresuchacontract isnot reduced towriting, thecompany shall within one month after the allotment deliver to the Registrar for registration the prescribed particulars of the contract stamped with the same stamp duty as would have been payable if the contract had been reduced to writing, and those particulars shall be deemed to be an instrument within the meaning of the Stamp DutyAct.

(3) Ifdefault ismade incomplyingwith thissection,everyofficer of the company who is in default shall be liable to a fine not exceeding one thousand dollars for every day during which the default continues:

Provided that, in the case of default in delivering to the Registrar within one month after the allotment any document required to be delivered by this section, the company, or any person liable for the default, may apply to the Court for relief and the Court, if satisfied that the omission to deliver the document was accidental or due to inadvertence or that it is just and equitable to grant relief, may make an orderextending the timefor thedeliveryof thedocument for suchperiod as the Court may think proper.

Commissions, etc.

53.—(1) It shall be lawful for a company to pay a commission to any person in consideration of his subscribing or agreeing to subscribe, whether absolutely or conditionally, for any shares in the company, or procuring or agreeing to procure subscriptions, whether absolute or conditional, for any shares in the company if—

(a) the payment of the commission is authorized by the articles; and

(b) the commission paid or agreed to be paid does not exceed ten per centum of the price at which the shares are issued or the amount or rate authorized by the articles, whichever is the less; and

Power to pay certain commissions, and prohibition of payment of all other commissions, etc.

45The Companies Act, 2004 [No. ]

(c) the amount or rate per centum of the commission paid or agreed to be paid is—

(i) in the case of shares offered to the public for subscription, disclosed in the prospectus; or

(ii) in the case of shares not offered to the public for subscription, disclosed in the statement in lieu of prospectus, or in a statement in the prescribed form signed in like manner as a statement in lieu of prospectus and delivered before the payment of thecommission to theRegistrar for registration, and, where a circular or notice, not being a prospectus, inviting subscription for the shares is issued, also disclosed in that circular or notice; and

(d) the number of shares which persons have agreed for a commission to subscribe absolutely is disclosed in manner aforesaid.

(2) Save as aforesaid, no company shall apply any of its shares or capital money either directly or indirectly in payment of any commission, or allowance, to any person in consideration of his subscribing or agreeing to subscribe, whether absolutely or conditional, for any shares of the company, or procuring or agreeing to procure subscriptions, whether absolute or conditional, for any shares in the company, whether the shares or money be so applied by being added to the purchase money of any property acquired by the company or to the contract price of any work to be executed for the company, or the moneybepaidoutof thepurchasemoneyorcontractprice,orotherwise.

(3) Nothing in this sectionshall affect thepowerofanycompany to pay such brokerage as it has heretofore been lawful for a company to pay.

(4) A vendor to, promoter of, or other person who receives payment in money or shares from, a company shall have and shall be deemed always to have had power to apply any part of the money or

[No. ] The Companies Act, 200446

sharessoreceivedinpaymentofanycommission, thepaymentofwhich, if made directly by the company, would have been legal under this section.

(5)Acompany which contravenes any of the provisions of this section and every officer of the company who knowingly authorizes or permits the contravention shall be liable to a fine not exceeding fifty thousand dollars.

54.—(1)Whereacompanyhaspaidanysumsbywayofcommission in respect of any shares or debentures, as the total amount so paid, or so much thereof as has not been written off, shall be stated in every balance sheet of the company until the whole amount thereof has been writtenoff.

(2) If default ismadeincomplyingwith thissection, thecompany and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

Construction of References to Offering Shares or Debentures to the Public

55.—(1)Any reference in thisAct to offering shares or debentures to the public shall, subject to any provision to the contrary contained therein, be construed as including a reference to offering them to any section of the public, whether selected as members or debenture holders of the company concerned or as clients of the person issuing the prospectus or in any other manner, and references in this Act or in a company’s articles to invitations to the public to subscribe for shares or debentures shall, subject as aforesaid, be similarly construed.

(2) Subsection (1) shall not be taken as requiring any offer or invitation to be treated as made to the public if it can properly be regarded, in all the circumstances, as not being calculated to result, directly, or indirectly, in the shares or debentures becoming available for subscription or purchase by persons other than those receiving the offer or invitation, or otherwise as being a domestic concern of the persons making and receiving it, and in particular—

(a) a provision in a company’s articles prohibiting invitations to the public to subscribe for shares or debentures shall not be

Statement in balance sheet, as to commissions.

Construction of references to offering shares or debentures to the public.

47The Companies Act, 2004 [No. ]

taken as prohibiting the making to members or debenture holders of an invitation which can properly be regarded as aforesaid; and

(b) the provisions of thisAct relating to private companies shall be construed accordingly.

Issue of Redeemable Shares

56.—(1) Subject to this section, a company may, if so authorized by its articles, issue shares which by the terms of the issue will be redeemed or, at the option of the company, may be redeemed.

(2) No redeemable shares may be issued at a time when there are no issued shares of the company which are not redeemable.

(3) Redeemable shares may not be redeemed unless they are fully paid and the terms of redemption must provide for payment on redemption.

(4) Notwithstanding anything in the company’s articles—

(a) no shares issued as provided in subsection (1) shall be redeemed except out of the company’s profits or revenue reserveswhichwouldotherwisebeavailable for thepayment of dividends, or out of proceeds of a fresh issue of shares made for the purpose of the redemption; and

(b) the minimum premium (if any) payable on redemption shall be provided out of the company’s profits or revenue reserves which would otherwise be available for the payment of dividends or out of a fresh issue of shares before the shares are redeemed.

(5) If a company acts in contravention of this section, the company and every officer thereof who knowingly authorizes the contraventionshallbe liable toafinenotexceedingfifty thousanddollars.

57.—(1) Subject to thisAct, redemption of shares may be effected onsuch termsand insuchmannerasmaybeprovidedby thecompany’s articles.

(2) Where shares are redeemed under this section, the voting rights attaching to those shares shall be suspended and the amount of

Power to issue redeemable shares.

Financing etc. of redemption.

[No. ] The Companies Act, 200448

the company's issued share capital shall be diminished by the value attributed to those shares in the stated capital account accordingly, but the redemption of shares by a company is not to be taken as reducing the amount of the company's authorized number of shares.

(3) Without prejudice to subsection (1), where a company is about to redeem shares, it has power to issue shares up to the value of the shares to be redeemed as if those shares had never been issued.

58.—(1) Subject to subsection (4) and its articles, a company may purchase or otherwise acquire shares issued by it.

(2) Section 57 shall apply to the purchase by a company under this section of its own shares as it applies to the redemption of redeemable shares, save that the terms and manner of purchase need not be determined by the articles as required by section 57 (1).

(3) Acompany may not under this section purchase its shares if as a result of the purchase there would no longer be any member of the company holding shares other than redeemable shares.

(4) A company shall not make any payment to purchase or otherwise acquire shares issued by it unless a statutory declaration is made by the company’s directors in accordance with this Act and lodged with the Registrar, to the effect that there are no reasonable grounds for believing that—

(a) the company is, or would after the payment be, unable to pay its liabilities as they become due; or

(b) the realizable value of the company’s assets would, after the payment,be less than theaggregateof its liabilitiesandstated capital.

(5) Thestatutorydeclarationunder subsection (4) shall bebased on—

(a) the company's audited accounts made up no more than 12 months before the date of the statutory declaration;

(b) the company's unaudited accounts made up no more than 45 days before the date of the statutory declaration; and

Power of company to purchase own shares.

49The Companies Act, 2004 [No. ]

(c) any other relevant facts of which the directors are aware.

(6) This section does not apply to a purchase or acquisition of a kind referred to in section 59.

(7) Thedirectorsofacompanywhowillfullyor recklesslymake a declaration under subsection (4), a statement which is false in any material particular, shall be liable on summary conviction before a Resident Magistrate, to a fine not exceeding one million dollars or to imprisonment for a term not exceeding two years or to both such fine and imprisonment.

59.—(1) Subject to subsection (3) and if permitted by its articles, a company may purchase or otherwise acquire shares issued by it—

(a) to settle or compromise a debt or claim asserted by or against the company;

(b) to eliminate fractional shares; or

(c) to fulfil the termsof anon-assignableagreementunderwhich the company has an option or is obliged to purchase shares owned by an officer or an employee of the company.

(2) Section 57 shall apply to the purchase or other acquisition by a company under this section of its own shares as it applies to the redemption of redeemable shares, save that the terms and manner of purchase or other acquisition need not be determined by the articles as required by section 57 (1).

(3) Acompanymaypurchaseorotherwiseacquire shares issued by it to comply with an order under section 213.

(4) A company shall not make any payment to purchase or acquire under subsection (1) shares issued by it unless a statutory declaration is made by the company’s directors and lodged with the Registrar for registration to theeffect that therearenoreasonablegrounds forbelieving that—

(a) the company is, or would after the payment be, unable to pay its liabilities as they become due; or

(b) the realizable value of the company’s assets would after the payment be less than the aggregate of its liabilities and the

Alterative acquisition of Company's own shares.

[No. ] The Companies Act, 200450

amount requiredforpaymentonaredemptionor inawinding up of all shares the holders of which have the right to be paid prior to or rateably with the holders of the shares to be purchased or acquired.

(5) The declaration under subsection (4) shall be based on—

(a) the company's audited accounts made up no more than 12 months before the date of the statutory declaration;

(b) the company's unaudited accounts made up no more than 45 days before the date of the statutory declaration; and

(c) any other relevant facts of which the directors are aware.

(6) Acompany may accept from any shareholder a share in the company surrendered to it as a gift, but may not extinguish or reduce a liability in respect of an amount unpaid on any such share, except in accordance with section 71.

(7) The directors of a company who wilfully or recklessly make a declaration under subsection (4), a statement which is false in any material particular, shall be liable on summary conviction before a Resident Magistrate, to a fine not exceeding one million dollars or to imprisonment for a term not exceeding two years or to both such fine and imprisonment.

60. Acompany shall, within thirty days of the purchase of any of its issued shares, notify its shareholders of—

(a) the number of shares it has purchased;

(b) the names of the shareholders from whom it has purchased the shares;

(c) the price paid for the shares;

(d) if the consideration was other than cash, the nature of the consideration and the value attributed to it; and

(e) the balance, if any, remaining due to shareholders or those shareholders from whom it purchased the shares.

61.—(1) If the articles so provide, no shares or a class of shares may be issued unless the shares have first been offered to the shareholders of the company holding shares of that class.

Notice to shareholders of purchase by company of own shares.

Pre-emptive rights.

51The Companies Act, 2004 [No. ]

(2) The shareholders mentioned in subsection (1) have a pre- emptive right to acquire the offered shares in proportion to their holding at such price and on such terms as those shares are to be offered to others.

(3) Notwithstanding that the articles provide the pre-emptive right referred to in subsection (1), the shareholders of the company have no pre-emptive right in respect of shares to be issued by the company—

(a) for consideration other than cash;

(b) pursuant to the exercise of conversion privileges, options or rights previously granted by the company.

62.—(1) Subject to the provisions of this section, a company limited by shares may, if so authorized by its articles, issue preference shares which are, or at the option of the company, are to be liable to be redeemed:

Provided that—

(a) no such shares shall be redeemed except out of profits of thecompanywhichwouldotherwisebeavailablefordividend or out of the proceeds of a fresh issue of shares for the purposes of the redemption;

(b) no such shares shall be issued unless they are fully paid;

(c) the premium, if any, payable on redemption, must havebeen provided for out of the company’s profits before the shares are redeemed;

(d) where any such shares are redeemed otherwise than out of the proceeds of a fresh issue, there shall out of profits that would otherwise have been available for dividend be transferred to a reserve fund to be called “the capital redemption reserve fund”, a sum equal to the amount of the shares to be redeemed, and the provisions of thisAct relating to the reduction of a company’s share capital shall, except as provided in this section, apply as if the capital redemption reserve fund were the company’s paid up share capital.

Power to issue redeemable preference shares.

[No. ] The Companies Act, 200452

(2) Subject to the provisions of this section, the redemption of preference shares thereunder may be effected on such terms and in such manner as may be provided by the articles.

(3) The redemption of preference shares by a company under this section shall not be taken as reducing the amount of the company’s stated capital.

(4) Where inpursuanceof this sectionacompanyhas redeemed or is about to redeem any preference shares, it shall have power to issue shares up to the amount of the shares redeemed or to be redeemed as if thoseshareshadneverbeen issued, andaccordingly thecompany’s sharecapital shallnot for thepurposesof theStampDutyActbedeemed to be increased by the issue of shares in pursuance of this subsection:

Provided that, where new shares are issued before the redemption of the old shares, the new shares, shall not, so far as relates to stamp duty, be deemed to have been issued in pursuance of this section unless the old shares are redeemed within a month after the issue of the new shares.

(5) The capital redemption reserve fund may, notwithstanding anything in this section, be applied by the company in paying up the company’s unissued shares to be issued to the company’s members as fully paid bonus shares.

(6) If a company acts in contravention of this section, the company and every officer of the company who knowingly authorizes or permits the contravention shall be liable to a fine not exceeding fifty thousand dollars.

Miscellaneous Provisions as to Share Capital

63. Acompany, if so authorized by its articles, may do any one or more of the following—

(a) make arrangements on the issue of shares for a difference between the shareholders in the amounts and times of payment of calls on their shares;

(b) accept from any member the whole or a part of the amount remaining unpaid on any shares held by him, although no part of that amount has been called up;

Power of company to arrange for different amounts being paid on shares.

53The Companies Act, 2004 [No. ]

(c) pay dividend in proportion to the amount paid up on each share where a larger amount is paid up on some shares than on others.

64. Alimited company may by special resolution determine that any portion of its share capital which has not been already called up shall not be capable of being called up, except in the event and for the purposes of the company being wound up, and thereupon the portion of its share capital shall not be capable of being called up except in the event and for the purposes aforesaid.

65.—(1) A company limited by shares or a company limited by guarantee and having a share capital, if so authorized by its articles, may alter the conditions of its articles as follows, that is to say, it may—

(a) increase its share capital by new shares of such amount as it thinks expedient;

(b) consolidateanddividealloranyof its sharecapital intoshares of larger amount than its existing shares;

(c) convert all or any of its paid up shares into stock, and reconvert that stock intopaidupsharesofanydenomination;

(d) subdivide its shares, or any of them, into shares of smaller amount than is fixed by the articles, so, however, that in the subdivision the proportion between the amount paid and the amount, if any, unpaid on each reduced share shall be the sameas itwas in thecaseof theshare fromwhich the reduced share is derived;

(e) cancel shares which, at the date of the passing of the resolution in that behalf, have not been taken or agreed to be taken by any person, and diminish the amount of its share capital by the amount of the shares so cancelled.

(2) The powers conferred by this section must be exercised by the company in general meeting.

(3) Acancellation of shares in pursuance of this section shall not be deemed to be a reduction of share capital within the meaning of thisAct.

Reserve liability of limited company.

Power of company limited by shares to alter its share capital.

[No. ] The Companies Act, 200454

66.—(1) If a company having a share capital has—

(a) consolidatedanddivided its sharecapital intosharesof larger amount than its existing shares; or

(b) converted any shares into stock; or

(c) re-converted stock into shares; or

(d) subdivided its shares or any of them; or

(e) redeemed any redeemable preference shares; or

(f) cancelled any shares, otherwise than in connection with a reduction of share capital under section 71,

itshallwithinonemonthaftersodoinggivenoticethereof totheRegistrar specifying, as the case may be, the shares consolidated, divided, converted, subdivided, redeemed or cancelled, or the stock re- converted.

(2) Ifdefault ismadeincomplyingwith thissection, thecompany and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

67.—(1) Whereacompanyhavingasharecapital,whether its shares have or have not been converted into stock, has increased its share capital beyond the registered capital, it shall within fifteen days after the passing of the resolution authorizing the increase, give to the Registrar notice of the increase, and the Registrar shall record the increase.

(2) The notice to be given as aforesaid shall include such particulars as may be prescribed with respect to the classes of shares affected and the conditions subject to which the new shares have been or are to be issued, and there shall be forwarded to the Registrar together with the notice and a copy of the resolution authorizing the increase.

(3) Ifdefault ismadeincomplyingwith thissection, thecompany and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

68. An unlimited company having a share capital may, by its resolution for registrationasa limitedcompany inpursuanceof thisAct, do either or both of the following, namely—

(a) increase the amount of its share capital by increasing the amount of its shares, subject to the condition that no part of

Notice to Registrar of consolidation of share capital, conversion of shares into stock etc.

Notice of increase of share capital.

Power of unlimited company to provide for reserve capital share on registration.

55The Companies Act, 2004 [No. ]

the increasedcapital shallbecapableofbeingcalledupexcept in theeventandfor thepurposesof thecompanybeingwound up;

(b) provide that a specified portion of its uncalled share capital shall not be capable of being called up except in the event and for the purposes of the company being wound up.

69.—(1) Where any shares of a company are issued for the purpose of raising money to defray the expenses of the construction of any works or buildings or the provision of any plant which cannot be made profitable for a lengthened period, the company may pay interest on so much of that share capital as is for the time being paid up for the period and subject to the conditions and restrictions mentioned in this section, and may charge the sum so paid by way of interest to capital as part of the cost of construction of the work or building, or the provision of plant:

Provided that—

(a) no such payment shall be made unless it is authorized by the articles or by special resolution;

(b) no such payment, whether authorized by the articles or by special resolution,shallbemadewithout theprevioussanction of the Minister;

(c) before sanctioning any such payment the Minister may, at the expense of the company, appoint a person to inquire and report to him as to the circumstances of the case, and may, before making the appointment, require the company to give security for the payment of the costs of the inquiry;

(d) the payment shall be made only for such period as may be determined by the Minister, and that period shall in no case extend beyond the close of the half year next after the half year during which the works or buildings have been actually completed or the plant provided;

(e) the rate of interest shall in no case exceed six per centum per annum or such other rate as may for the time being be prescribed by the Minister;

Power of company to pay interest out of capital in certain cases.

[No. ] The Companies Act, 200456

(f) the accounts of the company shall show the share capital on which, and the rate at which, interest has been paid out of capital during the period to which the accounts relate.

(2) Ifdefault ismade incomplyingwithproviso (f) tosubsection (1), the company and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

70.—(1) Acompany limited by shares may, if so authorized by its articles, purchase its own shares out of profits available for distribution or out of a fresh issue of shares for that purpose and in accordance with the provisions of this section.

(2) Where a company, in the operation of an employee share ownership plan approved under the Employee Share Ownership Plan Act—

(a) purchases its shares and such shares are thereupon either cancelled or transferred to the trustees of the plan; or

(b) otherwise cancels its shares,

in the exercise of the company’s rights or obligations under thatAct or any plan thereunder, such purchase or cancellation of its shares by the companyshallnotbedeemed tobea reductionof thecompany’scapital.

(3) The purchase of shares in accordance with this section shall not be taken as reducing the amount of the company’s stated capital.

Reduction of Share Capital

71.—(1) Subject to subsection (3), a company may by special resolution—

(a) extinguishor reducea liability in respectofanamountunpaid on any shares;

(b) reduce its stated capital by an amount that is not represented by realizable assets; or

(c) return to its shareholders any of its assets which are in excess of the wants of the company.

Reduction of stated capital.

Redemption or cancellation of shares under Employees Share Ownership Plan Act.

57The Companies Act, 2004 [No. ]

(2) The stated capital of a company shall be reduced in accordance with any resolution under subsection (1) which reduces or has the effect of reducing the stated capital.

(3) A company shall not reduce its stated capital under subsection (1) (a) or return assets pursuant to subsection (1) (c) unless a statutory declaration is made by the directors of the company to the effect that there were no reasonable grounds for believing—

(a) that after the reduction or, as the case may be, return, the companywouldbeunable topay its liabilitiesas theybecome due; or

(b) that the realizable value of the company’s assets would thereby be less than the aggregate of its liabilities and the stated capital remaining after the reduction in accordance with subsection (2).

(4) The declaration under subsection (3) shall be based on—

(a) the company's audited accounts made up no more than 12 months before the date of the statutory declaration;

(b) the company's unaudited accounts made up no more than 45 days before the date of the statutory declaration; and

(c) any other relevant facts of which the directors are aware.

(5) Acompany shall at two intervals at least seven days apart, give notice in a daily newspaper circulating in the Island of—

(a) any reduction of its stated capital pursuant to subsection (l) (b); or

(b) any intention to reduce its stated capital under subsection (l) (a) or (c).

(6) A company shall not return assets to shareholder under subsection (1) (c) until the expiration of one hundred and eighty days after the publication of the second notice required under subsection (5).

(7) Adirector of a company who wilfully or recklessly makes, in any declaration under subsection (3), a statement which is false in a

[No. ] The Companies Act, 200458

material particular shall be liable on summary conviction in a Resident Magistrate’s Court to a fine not exceeding one million dollars or to imprisonment for a term not exceeding two years or to both such fine and imprisonment.

72.—(1) Subject to subsection (2), no redemption, purchase, acquisition or forfeiture by a company of its shares nor the cancellation of shares so redeemed, purchased, acquired or forfeited shall operate to reduce the authorized number of shares of the company.

(2) The stated capital of a company shall be reduced by the amount by which a redemption of redeemable shares is made out of a fresh issue of shares made for the purpose of the redemption not more than twelve months before the date of the redemption.

(3) Subject to this section, a company may not reduce its stated capital except as provided in section 71.

(4) The provisions of section 71 shall not apply to a redemption, purchase, acquisition or forfeiture.

Variation of Shareholders' Rights

73.—(1) If in the case of a company the share capital of which is divided into different classes of shares—

(a) provision is made by the articles for authorizing the variation of the rights attached to any class of shares in the company, subject to—

(i) the consent of any specified proportion of the holders of the issued shares of that class; or

(ii) the sanction of a resolution passed at a separate meeting of the holders of those shares; and

(b) in pursuance of the said provision the rights attached to any such class of shares are at any time varied,

the holders of not less in the aggregate than fifteen per centum of the issued shares of that class, being persons who did not consent to or vote in favour of the resolution for the variation, may apply to the Court tohave thevariationcancelled, and,whereanysuchapplication ismade,

Effect of redemption, purchase, etc.

Rights of holders of special classes of shares.

59The Companies Act, 2004 [No. ]

the variation shall not have effect unless and until it is confirmed by the Court.

(2) Anapplicationunderthissectionmustbemadewithintwenty- eightdaysafter thedateonwhich theconsentwasgivenor the resolution was passed, as the case may be, and may be made on behalf of the shareholders entitled to make the application by such one or more of their number as they may appoint in writing for the purpose.

(3) Onanysuchapplication theCourt, afterhearing theapplicant and any other persons who apply to the Court to be heard and appear to the Court to be interested in the application, may, if it is satisfied, having regard to all the circumstances of the case, that the variation would unfairly prejudice the shareholders of the class represented by theapplicant, disallowthevariationandshall, if not sosatisfied, confirm the variation.

(4) The decision of the Court on any such application shall be final.

(5) The company shall within fifteen days after the making of an order by the Court on any such application forward a copy of the order to theRegistrar, and, if default ismade incomplyingwith thisprovision, the company and every officer of thecompany who is in default shall be liable to a fine not exceeding fifty thousand dollars.

(6) In thissection theexpression"variation” includesabrogation, and for the purposes of this Act any resolution of a company the implementation of which would have the effect of diminishing the proportion of the total votes exercisable at a general meeting of the company by the holders of the existing shares of a class, or of reducing the proportion of the dividends or distributions payable at any time to the holders of the existing shares of a class, shall be deemed to be a variation of the rights of that class.

Transfer of Shares and Debentures, Evidence of Title, etc.

74.—(1) The shares or other interest of any member in a company shall be personal estate, transferable in manner provided by the articles of the company, and shall not be of the nature of real estate.

Nature and numbering of shares.

[No. ] The Companies Act, 200460

(2) Each share in a company having a share capital shall be distinguished by its appropriate number.

75.—(1) Notwithstanding anything in the articles of a company, it shall not be lawful for the company to register a transfer of shares in or debentures of the company unless a proper instrument of transfer has been delivered to the company:

Provided that nothing in this section shall prejudice any power of the company to register as shareholder or debenture holder any person to whom the right to any shares in or debentures of the company has been transmitted by operation of law.

(2) If a company contravenes the provisions of this section the company and every officer of the company who knowingly authorizes or permits the contravention shall be liable to a fine not exceeding fifty thousand dollars.

76. On the application of the transfer of any share or interest in a company, the company shall enter in its register of members the name of the transferee in the same manner and subject to the same conditions as if the application for the entry were made by the transferee.

77.—(1) If a company refuses to register a transfer of any shares or debentures, the company shall, within three months after the date on which the transfer was lodged with the company, send to the transferee notice of the refusal.

(2) Ifdefault ismadeincomplyingwith thissection, thecompany and every officer of the company who is in default shall be liable to a fine not exceeding two thousand dollars for every day during which the default continues.

78.—(1) Thecertificationbyacompanyofany instrumentof transfer of shares in or debentures of the company shall be taken as a representation by the company to any person acting on the faith of the certification that there have been produced to the company such documents as on the face of them show a prima facie title to the shares or debentures in the transferor named in the instrument of transfer, but not as a representation that the transferor has any title to the shares or debentures.

Transfer not to be registered except on production of instrument of transfer.

Registration of transfer on request of transferor.

Notice of refusal to register transfer.

Certification of transfers.

61The Companies Act, 2004 [No. ]

(2) Where any person acts on the faith of a false certification by a company made negligently, the company shall be under the same liability to him as if the certification had not been made fraudulently.

(3) For the purposes of this section—

(a) an instrument of transfer shall be deemed to be certificated if it bears the words “certificate lodged” or words to the like effect;

(b) the certification of an instrument of transfer shall be deemed to be made by a company if—

(i) the person issuing the instrument is a person authorized to issue certificated instruments of transfer on the company’s behalf; and

(ii) the certification is signed by a person authorized to certify transfers on the company’s behalf or by any officer or servant either of the company or of a body corporate so authorized;

(c) a certification shall be deemed to be signed by any person if—

(i) it purports to be authenticated by his signature or initials (whether handwritten or not); and

(ii) it is not shown that the signature or initials was or were placed there neither by himself nor by any person authorised to use the signature or initials for the purpose of certifying transfers on the company’s behalf.

79.—(1) Everycompanyshall,within twomonthsafter theallotment of any of its shares, debentures, or debenture stock and within three monthsafter thedateonwhicha transferofanysuchshares,debentures, or debenture stock, is lodged with the company, complete and have ready for delivery the certificates of all shares, the debentures, and the certificates of all debenture stock allotted or transferred, unless the conditions of issue of the shares, debentures, or debenture stock otherwise provide.

Duties of company with respect to issue of certificates.

[No. ] The Companies Act, 200462

(2) In subsection (1) “transfer” means a transfer duly stamped andotherwisevalid, anddoesnot includesucha transferas thecompany is for any reason entitled to refuse to register and does not register.

(3) If default ismadeincomplyingwiththissection, thecompany and every officer who is in default shall be liable to a fine not exceeding fifty thousand dollars.

(4) If any company on whom a notice has been served requiring thecompany tomakegoodanydefault incomplyingwith theprovisions of subsection (1) fails to make good the default within ten days after the service of the notice, the Court may, on the application of the person entitled tohave thecertificatesor thedebenturesdelivered tohim, make an order directing the company and any officer of the company to make good the default within such time as may be specified in the order, and any such order may provide that all costs of and incidental to the application shall be borne by the company or by any officer of the company responsible for the default.

80. Acertificate, under the common seal of the company, specifying any shares held by any member, shall be prima facie evidence of the title of the member to the shares.

81. The production to a company of any document which is by law sufficient evidence of probate of the will, or letters of administration of the estate, of a deceased person having been granted to some person shallbeacceptedbythecompany,notwithstandinganythinginitsarticles, as sufficient evidence of the grant.

82.—(1) Acompany limitedbyshares, if soauthorizedby its articles, may, with respect to any fully paid up shares, issue under its common seal a warrant stating that the bearer of the warrant is entitled to the shares therein specified, and may provide, by coupons or otherwise, for the payment of the future dividends on the shares included in the warrant.

(2) Such a warrant as aforesaid is in thisAct termed a “share warrant".

(3) Ashare warrant shall entitle the bearer thereof to the shares therein specified, and the shares may be transferred by delivery of the warrant.

Certificate evidence of title.

Evidence of grant of probate.

Issue and effect of share warrants to bearer.

63The Companies Act, 2004 [No. ]

83. If any person falsely and deceitfully personates any owner of any share or interest in any company, or of any share warrant or coupon, issued in pursuance of thisAct, and thereby obtains or endeavours to obtain any such share or interest or share warrant or coupon, or receives or endeavours to receive any money due to any such owner, as if the offender were the true and lawful owner, he shall be guilty of a felony, and shall on conviction on indictment be liable to be imprisoned with or without hard labour for fourteen years or to a fine.

Special Provisions as to Debentures

84.—(1) Acompany which issues or has issued debentures shall keep, in one or more books, a register of holders of debentures and shall enter therein the following particulars—

(a) the names and addresses of the debenture holders;

(b) the debentures held by each debenture holder, together with the amount paid or agreed to be considered as paid thereon, and any other prescribed particulars;

(c) the date at which each person was entered in the register as a debenture holder; and

(d) the date at which any person ceased to be a debenture holder:

Provided that—

(i) in the application of paragraph (b) to debenture stock and holders thereof it shall not be necessary for the register to show the amount paid or agreed to be considered as paid on such stock; and

(ii) nothing in this subsectionshall apply in relation to debentures which are transferable by delivery.

(2) The register of holders of debentures shall be kept at the registered office of the company:

Provided that—

(a) if the work of making it up is done at another office of the company, it may be kept at that other office; and

(b) if the company arranges with some other person for the making up of the register to be undertaken on behalf of the

Penalty for personation of shareholders.

Register of debenture holders.

[No. ] The Companies Act, 200464

company by that other person, it may be kept at the office of that other person at which the work is done,

so, however, that it shall not be kept at a place outside the Island.

(3) Every company shall send notice to the Registrar of the place where its register of holders of debentures is kept and of any change in that place:

Provided that a company shall not be bound to send notice under this subsection where the register has, at all times since it came into existence or, in the case of a register in existence on the appointed day, at all times since then been kept at the registered office of the company.

(4) Ifdefault ismadeincomplyingwith thissection, thecompany and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

85. Where, by virtue of proviso (b) to subsection (2) of section 84, the register of holders of debentures is kept at the office of some person other than thecompany, andbyreasonofanydefaultof his thecompany fails to comply with subsection (3) of that section or section 86 or with any of the requirements of thisAct as to the production of the register, that other person shall be liable to the same penalties as if he were an officer of the company who was in default, and the power of the Court under subsection (6) of section 86 shall extend to the making of orders against that other person and his officers and servants.

86.—(1) Every register of holders of debentures of a company shall, exceptwhendulyclosed,beopen to the inspectionwithoutcharge of the registered holder of any such debentures and of any holder of shares in the company and, on payment of fifty dollars or such less sum as the company may specify for each inspection, of any other person, butsubject tosuchreasonable restrictionsas thecompanymayingeneral meeting impose, so that not less than two hours in each day shall be allowed for inspection.

(2) For the purposes of subsection (1), a register shall be deemed to be duly closed if closed in accordance with provisions contained in the articles or in the debentures or, in the case of debenture stock, in the stock certificates, or in the trust deed or other document

Consequences of failure to comply with requirements as to register of debenture holders owing to agent's default.

Inspection of register of debenture holders.

65The Companies Act, 2004 [No. ]

securing the debentures or debenture stock, during such period or periods, not exceeding in the whole thirty days in any year, as may be therein specified.

(3) Any person may require a copy of the register of holders of debentures of the company or any part thereof on payment of twenty dollars for every page required to be copied.

(4) Acopy of any trust deed or other document securing any issue of debentures shall be forwarded to every holder of any such debentures at his request on payment of twenty dollars for every page required to be copied.

(5) If inspection is refused, or a copy is refused or not forwarded, the company and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

(6) Where a company is in default as aforesaid, the Court may by order compel an immediate inspection of the register or direct that the copies required shall be sent to the person requiring them.

87.—(1) The provisions of section 115 (except subsection (4)) and sections 116 and 117 shall apply to and in relation to registers of holders of debentures as they apply to and in to relation to registers of members.

(2) The provisions of sections 118 and 119 shall apply to and in relation to the keeping by companies (whether having a share capital or not) whose business comprise the transaction of business in countries outside the Island of branch registers of holders of debentures resident outside the Island and the registering of holders of debentures therein as they apply to and in relation to the keeping by companies referred to in section 118 of branch registers of members so resident and the registering of members therein, so, however, that—

(a) so much of subsection (2) of section 119 as relates to advertisement before closing a register shall not apply; and

(b) there shall be substituted for the reference in subsection (7) of section 119 to proviso (b) to subsection (2) of section 109 a reference to proviso (b) to subsection (2) of section 84.

Application to registers of debenture holders of certain provisions relating to registers of members.

[No. ] The Companies Act, 200466

88.—(1) Subject to the following provisions of this section, any provision contained in a trust deed for securing an issue of debentures, or in any contract with the holders of debentures secured by a trust deed, shall be void in so far as it would have the effect of exempting a trustee thereof from or indemnifying him against liability for breach of trust where he fails to show the degree of care and diligence required of himas trustee,havingregard to theprovisionsof the trustdeedconferring on him any powers, authorities or discretions.

(2) Subsection (1) shall not invalidate—

(a) any release otherwise validly given in respect of anything done or omitted to be done by a trustee before the giving of the release; or

(b) any provision enabling such a release to be given—

(i) on the agreement thereto of a majority of not less thanthree-fourths invalueof thedebentureholders present and voting in person or, where proxies are permitted, by proxy at a meeting summoned for the purpose; and

(ii) either with respect to specific acts or omissions or on the trustee dying or ceasing to act.

(3) Subsection (1) shall not operate—

(a) to invalidate any provision in force on the appointed day so longasanypersonthenentitled to thebenefitof thatprovision or afterwards given the benefit thereof under subsection (4) remains a trustee of the deed in question; or

(b) to deprive any person of any exemption or right to be indemnified in respect of anything done or omitted to be done by him while any such provision was in force.

(4) While any trustee of a trust deed remains entitled to the benefit of a provision saved by subsection (3), the benefit of that provision may be given either—

(a) to all trustees of the deed, present and future; or

Liability of trustees for debenture holders.

67The Companies Act, 2004 [No. ]

(b) to any named trustees or proposed trustees thereof, by resolution passed by a majority of not less than three-fourths in value of the debenture holders present in person or, where proxies are permitted, by proxy at a meeting summoned for the purpose in accordance with the provisions of the deed or, if the deed makes no provision for summoning meetings, ameetingsummonedfor thepurpose inanymannerapproved by the Court.

89. A condition contained in any debentures or in any deed for securing any debentures, whether issued or executed before or after theappointedday, shallnotbe invalidby reasononly that thedebentures are thereby made irredeemable or redeemable only on the happening of a contingency, however remote, or on the expiration of a period, however long, any rule of equity to the contrary notwithstanding.

90.—(1) Where either before or after the appointed day a company has redeemed any debentures previously issued, then—

(a) unless any provision to the contrary whether express or implied, is contained in the articles or in any contract entered into by the company; or

(b) unless the company has, by passing a resolution to that effect or by some other act, manifested its intention that the debentures shall be cancelled,

thecompanyshallhave, andshallbedeemedalways tohavehad,power to re-issue the debentures, either by re-issuing the same debentures or by issuing other debentures in their place.

(2) On a re-issue of redeemed debentures the person entitled to the debentures shall have, and shall be deemed always to have had, the same priorities as if the debentures had never been redeemed.

(3) Where a company has power to re-issue debentures which have been redeemed, particulars with respect to the debentures which can be so re-issued shall be included in every balance sheet of the company.

(4) Where a company has either before or after the appointed day deposited any of its debentures to secure advances from time to

Perpetual debentures.

Power to re- issue redeemed debentures in certain cases.

[No. ] The Companies Act, 200468

time on current account or otherwise, the debentures shall not be deemed to have been redeemed by reason only of the account of the company having ceased to be in debit whilst the debentures remained so deposited.

(5) The re-issue of a debenture or the issue of another debenture in its place under the power by this section given to, or deemed to have been possessed by, a company, whether the re-issue or issue was made before or after the appointed day, shall be treated as the issue of a new debenture for the purposes of stamp duty, but it shall not be so treated for the purposes of any provision limiting the amount or number of debentures to be issued:

Providedthatanypersonlendingmoneyonthesecurityofadebenture re-issued under this section which appears to be duly stamped may give the debenture in evidence in any proceedings for enforcing his security without payment of the stamp duty or any penalty in respect thereof, unless he had notice or, but for his negligence might have discovered, that the debenture was not duly stamped, but in any such case the company shall be liable to pay the proper stamp duty and penalty.

(6) Where any debentures which have been redeemed before the appointed day are re-issued subsequently to that date, the re-issue of the debentures shall not prejudice any right or priority which any person would have had under or by virtue of any mortgage or charge created before that date.

91. A contract with a company to take up and pay for any debentures of the company may be enforced by an order for specific performance.

92.—(1) Whereeithera receiver is appointedonbehalfof theholders of any debentures of the company secured by a floating charge, or possession is taken by or on behalf of those debentures of any property comprised in or subject to the charge, then, if the company is not at the time in course of being wound up, the debts which in every winding up are under the provisions of Part V relating to preferential payments to be paid in priority to all other debts, shall be paid out of any assets

Specific performance of contracts to subscribe for debentures.

Payment of certain debts out of assets subject to floating charge in priority to claims under the charge.

69The Companies Act, 2004 [No. ]

coming to the hands of the receiver or other person taking possession as aforesaid in priority to any claim for principal or interest in respect of the debentures.

(2) The periods of time mentioned in the said provisions of Part V shall be reckoned from the date of the appointment of the receiver or of possession being taken as aforesaid, as the case may be.

(3) Any payments made under this section shall be recouped as far as may be out of the assets of the company available for payment of general creditors.

PART III—REGISTRATION OF CHARGES

Registration of Charges with Registrar

93.—(1) Every charge created after the appointed day by a company registered in the Island, being a charge to which this section applies shall, so far as any security on the company’s property or undertaking is conferred thereby, be void against the liquidator and any creditor of the company, unless the prescribed particulars of the charge, together with the original or a copy certified in the prescribed manner of the instrument, if any, by which the charge is created or evidenced, are delivered to or received by the Registrar for registration in the manner required by thisAct prior to the commencement of the winding up of the company, but without prejudice to any contract or obligation for repayment of the money secured; and when a charge becomes void under this section, themoneysecured therebyshall immediatelybecome payable.

(2) Where—

(a) a charge to which subsection (3) applies is registered within twenty-one days of its creation, that charge shall for the purposes of priority (and subject to any agreement altering priorities) rank in priority to any charge created after it;

(b) a charge to which subsection (3) applies is created and is not registered until after twenty-one days after its creation, that charge shall for purposes of priority (and subject to any agreementalteringpriorities)bedeemedtohavebeencreated on the date of registration.

Registration of charges.

[No. ] The Companies Act, 200470

(3) This section applies to the following charges—

(a) a charge for the purpose of securing any issue of debentures;

(b) a charge on uncalled share capital of the company;

(c) a charge created or evidenced by an instrument which, if executedbyan individual,would require registrationasabill of sale;

(d) a charge on land, wherever situated, or any interest therein but not including a charge for any rent or other periodical sum issuing out of land;

(e) a charge on book debts of the company;

(f) a floating charge on the undertaking or property of the company;

(g) a charge on calls made but not paid;

(h) a charge on a ship or any share in a ship;

(i) a charge on goodwill, on a patent or a licence under a patent, on a trade mark or on a copyright or a licence under a copyright.

(4) Where a charge is created outside of the Island comprising property situated outside the Island, for the purpose of calculating the period for registration, the twenty-one days shall commence after the date on which the instrument or copy would, in due course of post, and if dispatched with due diligence, have been received in the Island.

(5) Where a charge is created in the Island but comprises property outside the Island, the instrument creating or purporting to create the charge or the copy thereof, as the case may be, may be sent for registration under this section notwithstanding that further proceedings may be necessary to make the charge valid or effectual according to the law of the country in which the property is situated.

(6) Where a negotiable instrument has been given to secure the payment of any book debts of a company the deposit of the instrument for the purpose of securing an advance to the company shall not for the purposes of this section be treated as a charge on those book debts.

71The Companies Act, 2004 [No. ]

(7) Where a series of debentures containing, or giving by reference to any other instrument, any charge to the benefit of which the debenture holders of that series are entitled pari passu is created by a company, it shall for the purposes of this section be sufficient if there are delivered to or received by the Registrar within twenty-one days after the execution of the deed containing the charge or if there is no such deed, after the execution of any debentures of the series, the followingparticulars—

(a) the total amount secured by the whole series; and

(b) the dates of the resolutions authorizing the issue of the series andthedateof thecoveringdeed, ifany,bywhich thesecurity is created or defined; and

(c) a general description of the property charged; and

(d) the names of the trustees, if any, for the debenture holders,

together with a copy of the deed containing the charge, certified to be a true copy by an attorney-at-law or an officer of the company, or, if there is no such deed, one of the debentures of the series:

Provided that, where more than one issue is made of debentures in the series, there shall be sent to the Registrar for entry in the register particulars of the date and amount of each issue, but an omission to do this shall not affect the validity of the debentures issued.

(8) Where any commission, allowance or discount has been paid or made either directly or indirectly by a company to any person in consideration of his subscribing or agreeing to subscribe, whether absolutely or conditionally, for any debentures of the company, or procuring or agreeing to procure subscriptions, whether absolute or conditional, for any such debentures, the particulars required to be sent forregistrationunder thissectionshall includeparticularsas totheamount or rate per centum of the commission, discount, or allowance so paid or made, but omission to do this shall not affect the validity of the debentures issued:

Provided that the deposit of any debentures as security for any debt of the company shall not for the purposes of this subsection be treated as the issue of the debentures at a discount.

[No. ] The Companies Act, 200472

(9) If default is made in complying with subsection (1), the company and every officer thereof who is in default shall be liable to a fine not exceeding fifty thousand dollars.

(10) In this Part the expression “charge” includes mortgage.

94.—(1) Where a charge requiring registration under this Act is created then—

(a) the registration of that charge in accordance with thisAct shall constitute notice to the world of the existence of that charge;

(b) where a subsequent charge is registered in accordance with thisAct in respect of the same property or undertaking and writtennotice thereof isgivento thepriorchargee, theamount secured by the prior charge shall not be increased to the prejudice of the later charge notwithstanding any provision to the contrary contained in the document creating the earlier charge.

(2) Where the amount secured by a charge is increased after the charge is registered, the particulars of the increase shall be sent to the Registrar for registration in the prescribed manner.

95.—(1) It shall be the duty of a company to send to the Registrar for registration the particulars of every charge created by the company and of the issues of debentures of a series requiring registration under section 93, but registration of any such charge may be effected on the application of any person interested therein.

(2) Where registration is effected on the application of some person other than the company, that person shall be entitled to recover from the company the amount of any fees properly paid by him to the Registrar on the registration.

(3) If any company makes default in sending to the Registrar for registration the particulars of any charge created by the company, or of the issues of debentures of a series requiring registration as aforesaid, then, unless the registration has been effected on the application of some other person, the company and every officer of the company

Effect of registration.

Duty of company to register charges created by company.

73The Companies Act, 2004 [No. ]

who is in default shall be liable to a default fine not exceeding fifty thousand dollars.

96.—(1) Where after the appointed day a company registered in the Island acquires any property which is subject to a charge of any such kind as would, if it had been created by the company after the acquisition of the property, have been required to be registered under this Part, the company shall cause the prescribed particulars of the charge, together with a copy (certified in the prescribed manner to be a correct copy) of the instrument, if any, by which the charge was created or isevidenced, tobedelivered to theRegistrar for registration inmanner required by thisAct within twenty-one days after the date on which the acquisition is completed:

Provided that, if the property is situated and the charge was created outside the Island, twenty-one days after the date on which the copy of the instrument could in due course of post, and if dispatched with due diligence,havebeenreceivedin theIslandshallbesubstitutedfor twenty- onedaysafter thecompletionof theacquisitionas the timewithinwhich the particulars and the copy of the instrument are to be delivered to the Registrar.

(2) Ifdefault ismadeincomplyingwith thissection, thecompany and every officer of the company who is in default shall be liable to a default fine not exceeding fifty thousand dollars.

97.—(1) The Registrar shall keep, with respect to each company, a register in the prescribed form of all the charges requiring registration under this Part and shall, on payment of the prescribed fee, enter in the register with respect to such charges the following particulars—

(a) in the case of a charge to the benefit of which the holders of a series of debentures are entitled, such particulars as are specified in subsection (7) of section 93;

(b) in the case of any other charge—

(i) if the charge is a charge created by the company, the date of its creation, and if the charge was a charge existing on property acquired by the company, the date of the acquisition of the property; and

Duty of company to register charges existing on property acquired.

Registrar to keep register of charges.

[No. ] The Companies Act, 200474

(ii) the amount secured by the charge; and

(iii) short particulars of the property charged; and

(iv) the persons entitled to the charge.

(2) The Registrar shall give a certificate under his hand of the registration of any charge registered in pursuance of this Part, stating the amount thereby secured, and the certificate shall be conclusive evidence that the requirements of this Part as to registration have been compliedwith.

(3) The register kept in pursuance of this section shall be open to inspection by any person on payment of the prescribed fee for each inspection.

(4) The Registrar shall keep a chronological index, in the prescribed form and with the prescribed particulars, of the charges entered in the register.

98.—(1) The company shall cause a copy of every certificate of registration given under section 97 to be indorsed on every debenture or certificate of debenture stock which is issued by the company, and the payment of which is secured by the charge so registered:

Providedthatnothingin thissubsectionshallbeconstruedasrequiring a company to cause a certificate of registration of any charge so given to be indorsed on any debenture or certificate of debenture stock issued by the company before the charge was created.

(2) If any person knowingly and wilfully authorizes or permits the delivery of any debenture or certificate of debenture stock which under the provisions of this section is required to have indorsed on it a copy of a certificate of registration without the copy being so indorsed upon it, he shall, without prejudice to any other liability, be liable to a fine not exceeding fifty thousand dollars.

99. The Registrar, on evidence being given to his satisfaction with respect to any registered charge—

(a) that the debt for which the charge was given has been paid or satisfied in whole or in part; or

Indorsement of certificate of registration on debentures.

Entries of satisfaction and release of property from charge.

75The Companies Act, 2004 [No. ]

(b) that part of the property or undertaking charged has been released from the charge or has ceased to form part of the company’s property or undertaking,

may enter on the register a memorandum of satisfaction in whole or in part, or of the fact that part of the property or undertaking has been released from the charge or has ceased to form part of the company’s property or undertaking, as the case may be, and where he enters a memorandum of satisfaction in whole he shall, if required, furnish the company with a copy thereof.

100. The Court, on being satisfied that the omission or mis-statement of any particular with respect to any such charge or in a memorandum of satisfaction was accidental, or due to inadvertence or to some other sufficient cause,or isnotofanature toprejudice thepositionofcreditors or shareholders of the company, or that on other grounds it is just and equitable to grant relief, may, on the application of the company or any person interested, and on such terms and conditions as seem to the Court just and expedient, order that the omission or mis-statement shall be rectified.

101.—(1) If any person obtains an order for the appointment of a receiver or manager of the property of a company, or appoints such a receiver or manager under any powers contained in any instrument, he shall, within seven days from the date of the order or of the appointment under the said powers, give notice of the fact to the Registrar and the Registrar shall, on payment of the prescribed fee enter the fact in the register of charges.

(2) Where any person appointed receiver or manager of the property of a company under the powers contained in any instrument, ceases to act as such receiver or manager, he shall, on so ceasing, give the Registrar notice to that effect, and the Registrar shall enter the notice in the register of charges.

(3) If any person makes default in complying with the requirements of this section he shall be liable to a fine not exceeding two thousand dollars for every day during which the default continues.

Rectification of register of charges.

Registration of enforcement of security.

[No. ] The Companies Act, 200476

Provisions as to Company’s Register of Charges and as to Copies of Instruments creating Charges

102.—(1) Every company shall cause a copy of every instrument creating any charge requiring registration under this Part to be certified in theprescribedmannerandkeptat theregisteredofficeof thecompany:

Provided that, in the case of a series of uniform debentures, a copy certified as aforesaid of one debenture of the series shall be sufficient.

(2) Ifdefault ismadebyacompanyincomplyingwithsubsection (1), the company and every officer of the company who is in default shall be liable to a fine not exceeding two thousand dollars.

103.—(1) Every limited company shall keep at the registered office of the company a register of charges and enter therein all charges specifically affecting property of the company and all floating charges on the undertaking or any property of the company, giving in each case a short description of the property charged, the amount of the charge, and, except in the case of securities to bearer, the names of the persons entitled thereto.

(2) If any officer of the company knowingly and wilfully authorizes or permits the omission of any entry required to be made in pursuance of this section, he shall be liable to a fine not exceeding one hundred thousand dollars.

104.—(1) The copies of instruments creating any charge requiring registrationunder thisPartwith theRegistrar, and the registerof charges kept in pursuance of section 103 shall be open during business hours (but subject to such reasonable restrictions as the company in general meeting may impose, so that not less than two hours in each day shall be allowed for inspection) to the inspection of any creditor or member of the company without fee, and the register of charges shall also be open to the inspection of any other person on payment of such fee, not exceeding fiftydollars for each inspection, as thecompanymayspecify.

(2) If inspection of the said copies or register is refused, any officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars and where the default continues to a further fine not exceeding two thousand dollars for every day during which the refusal continues.

Copies of instruments creating charges to be kept by company.

Company's register of charges.

Right to inspect copies of instruments creating charges and company's register of charges.

77The Companies Act, 2004 [No. ]

(3) If any such refusal occurs in relation to a company, the Court may by order compel an immediate inspection of the copies or register.

Application of Part III to Companies incorporated outside the Island

105. The provisions of this Part shall extend to charges on property in the Island which are created, and to charges on property in the Island which is acquired, after the appointed day, by a company (whether a company within by the meaning of thisAct or not) incorporated outside the Island which has an established place of business in the Island.

PART IV—MANAGEMENTANDADMINISTRATION

Registered Office and Name

106.—(1) A company shall have a registered office to which all communications and notices may be addressed.

(2) Notice of the situation of the registered office shall be given at the date of the company’s incorporation or within seven days of any change in such situation, as the case may be, to the Registrar, who shall record the same. The inclusion in the annual return of a company of a statement as to the address of its registered office shall not be taken to satisfy the obligation imposed by this subsection.

(3) Ifdefault ismadeincomplyingwith thissection, thecompany and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

107.—(1) Every company—

(a) shall paint or affix, and keep painted or affixed, its name on the outside of every office or place in which its business is carried on, in a conspicuous position, in letters easily legible;

(b) shall have its name engraven in legible characters on its seal;

(c) shall have its name mentioned in legible characters in all business letters of the company and in all notices and other

Application of Part III to charges created, and charges on property subject to charges acquired, by company incorporated outside the Island.

Registered office of company.

Publication of name by company.

[No. ] The Companies Act, 200478

officialpublicationsofthecompany,andinallbillsofexchange, promissory notes, indorsements, cheques and orders for money or goods purporting to be signed by or on behalf of the company, and in all bills of parcels, invoices, receipts and letters of credit of the company.

(2) If a company does not paint or affix its name in manner directed by thisAct, the company and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars, and if a company does not keep its name painted or affixed in manner so directed, the company and every officer of the company who is in default shall be liable to a fine not exceeding two thousand dollars for every day during which the default continues.

(3) If acompanyfails tocomplywithparagraph (b)orparagraph (c) of subsection (1), the company shall be liable to a fine not exceeding fifty thousand dollars.

(4) If an officer of a company or any person on its behalf—

(a) uses or authorizes the use of any seal purporting to be a seal of the company whereon its name is not so engraven as aforesaid; or

(b) issues or authorizes the issue of any business letter of the company or any notice or other official publication of the company, or signs or authorizes to be signed on behalf of the companyanybillofexchange,promissorynote, indorsement, cheque or order for money or goods wherein its name is not mentioned in the manner aforesaid; or

(c) issues or authorizes the issue of any bill of parcels, invoice, receipt or letter of credit of the company wherein its name is not mentioned in the manner aforesaid,

he shall be liable to a fine not exceeding fifty thousand dollars, and shall further be personally liable to the holder of the bill of exchange, promissory note, cheque or order for money or goods for the amount thereof unless it is duly paid by the company.

79The Companies Act, 2004 [No. ]

108.—(1) Where a company having a share capital has issued a prospectus inviting the public to subscribe for its shares, the company shall not commence any business or exercise any borrowing powers unless—

(a) shares held subject to the payment of the whole amount thereof in cash have been allotted to an amount not less in the whole than the minimum subscription; and

(b) every director of the company has paid to the company, on each of the shares taken or contracted to be taken by him and for which he is liable to pay in cash, a proportion equal to the proportion payable on application and allotment on the shares offered for public subscription; and

(c) there has been delivered to the Registrar for registration a statutory declaration by the secretary or one of the directors, in the prescribed form, that the conditions specified in paragraphs (a) and (b) have been complied with.

(2) Where a company having a share capital has not issued a prospectus inviting the public to subscribe for its shares, the company shall not commence any business or exercise any borrowing powers unless—

(a) there has been delivered to the Registrar for registration a statement in lieu of prospectus; and

(b) every director has paid to the company, on each of the shares taken or contracted to be taken by him and for which he is liable to pay in cash, a proportion equal to the proportion payable on application and allotment on the shares payable in cash;

(c) there has been delivered to the Registrar for registration a statutory declaration by the secretary or one of the directors, in the prescribed form, that paragraph (b) has been complied with.

(3) The Registrar shall, on the delivery to him of the statutory declaration, and, in the case of a company which is required by this

Restriction on com- mencement of business.

[No. ] The Companies Act, 200480

section to deliver a statement in lieu of prospectus, of such a statement, certify that the company is entitled to commence business; and that certificate shall be conclusive evidence that the company is so entitled.

(4)Any contract made by a company before the date at which it is entitled to commence business shall be provisional only, and shall not be binding on the company until that date, and on that date it shall become binding.

(5) Nothing in this section shall prevent the simultaneous offer for subscription or allotment of any shares and debentures or the receipt of any money payable on application for debentures.

(6) If anycompanycommencesbusinessorexercisesborrowing powers incontraventionof this section, everypersonwho is responsible for the contravention shall, without prejudice to any other liability, be liable to a fine not exceeding fifty thousand dollars for every day during which the contravention continues.

(7) Nothing in this section shall apply to a private company.

Register of Members

109.—(1) Every company shall keep in one or more documents a register of its members, and enter therein the following particulars—

(a) the names and addresses and the occupation, if any, of the members, and in thecaseofacompanyhavingasharecapital astatementof thesharesheldbyeachmember,distinguishing each share by its number, and of the amount paid or agreed to be considered as paid on the shares of each member;

(b) the date at which each person was entered in the register as a member;

(c) the date at which any person ceased to be a member:

Provided that where the company has converted any of its shares intostockandgivennoticeof theconversion to theRegistrar, the register shall show the amount of stock held by each member instead of the amount of shares and the particulars relating to shares specified in paragraph (a).

Register of members.

81The Companies Act, 2004 [No. ]

(2) The register of members shall be kept at the registered office of the company:

Provided that—

(a) if the work of making it up is done at another office of the company, it may be kept at that other office; and

(b) if the company arranges with some other person for the making up of the register to be undertaken on behalf of the company by that other person, it may be kept at the office of that other person at which the work is done,

so, however, that it shall not be kept at a place outside the Island.

(3) Every company shall send notice to the Registrar of the place where its register of members is kept and of any change in that place:

Provided that a company shall not be bound to send notice under this subsection where the register has, at all times since it came into existence or, in the case of a register in existence at the appointed day, at all times since then been kept at the registered office of the company.

(4)Whereacompanymakesdefault incomplyingwithsubsection (1) or makes default for fourteen days in complying with subsection (3), the company and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

110.—(1) Every company having more than fifty members shall, unless the register of members is in such a form as to constitute in itself an index, keep an index of the names of the members of the company and shall, within fourteen days after the date on which any alteration is made in the register of members, make any necessary alteration in the index.

(2) The index, which may be in the form of a card index, shall in respect of each member contain a sufficient indication to enable the account of that member in the register to be readily found.

(3) The index shall at all times be kept at the same place as the register of members.

Index of members of company.

[No. ] The Companies Act, 200482

(4) Ifdefault ismadeincomplyingwith thissection, thecompany and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

111.—(1) On the issue of a share warrant the company shall strike out of its register of members the name of the member then entered therein as holding the shares specified in the warrant as if he had ceased to be a member, and shall enter in the register the following particulars, namely—

(a) the fact of the issue of the warrant;

(b) astatementofthesharesincludedinthewarrant,distinguishing each share by its number; and

(c) the date of the issue of the warrant.

(2) The bearer of a share warrant shall, subject to the articles of the company, be entitled, on surrendering it for cancellation, to have his name entered as a member in the register of members.

(3) The company shall be responsible for any loss incurred by any person by reason of the company entering in the register the name of a bearer of a share warrant in respect of the shares therein specified without the warrant being surrendered and cancelled.

(4) Until the warrant is surrendered, the particulars specified in subsection (1) shall be deemed to be the particulars required by this Act to be entered in the register of members, and, on the surrender, the date of the surrender must be entered.

(5) Subject to the provisions of thisAct, the bearer of a share warrant may, if the articles of the company so provide, be deemed to be a member of the company within the meaning of thisAct, either to the full extent or for any purposes defined in the articles.

112.—(1) The register of members, commencing from the date of the registration of the company, and the index of the names of members, except when the register is closed under the provisions of thisAct, shall during business hours (subject to such reasonable restrictions as the company in general meeting may impose, so that not less than two hours in each day be allowed for inspection) be open to the inspection

Provisions as to entries in register in relation to share warrants.

Inspection of register of members and index of names.

83The Companies Act, 2004 [No. ]

of any member without charge and of any other person on payment of fifty dollars, or such less sum as the company may specify, for each inspection.

(2) Any member or other person may request a copy of the register, or of any part thereof, on payment of fifty dollars, or such less sumas thecompanymayspecify, foreveryhundredwordsor fractional part thereof required to be copied. The company shall cause any copy so required by any person to be sent to that person within a period of ten days commencing on the day next after the day on which the request is received by the company.

(3) If any inspection required under this section is refused or if any copy required under this section is not sent within the proper period, thecompanyandeveryofficerof thecompanywhois indefault shall be liable in respect of each offence to a fine not exceeding fifty thousand dollars.

(4) In the case of any such refusal or default, the Court may by order compel an immediate inspection of the register and index or direct that the copies required shall be sent to the persons requiring them.

113. Where, by virtue of proviso (b) to subsection (2) of section 109 the register of members is kept at the office of some person other than the company, and by reason of default of that other person the companyfails tocomplywithsubsection (3)of that section, subsection (3) of section 110 or subsection (1) of section 112 or with any requirements of thisAct as to the production of the register, that other person shall be liable to the same penalties as if he were an officer of the company who was in default, and the power of the Court under subsection (3) of section 112 shall extend to the making of orders against that other person and his officers and servants.

114. Acompany may, on giving notice by advertisement in a daily newspaper printed and circulating in the Island close the register of members for any time or times not exceeding in the whole thirty days in each year.

Consequences of failure to comply with requirements as to register owing to agent's default.

Power to close register.

[No. ] The Companies Act, 200484

115.—(1) If—

(a) the name of any person is, without sufficient cause, entered in or omitted from the register of members of a company; or

(b) default is made or unnecessary delay takes place in entering on the register the fact of any person having ceased to be a member,

the person aggrieved, or any member of the company, or the company, may apply to the Court for rectification of the register.

(2) Where an application is made under this section, the Court mayeither refuse theapplicationormayorder rectificationof the register and payment by the company of any damages sustained by any party aggrieved.

(3) On an application under this section the Court may decide any question relating to the title of any person who is a party to the application to have his name entered in or omitted from the register, whether the question arises between members or alleged members, or betweenmembersorallegedmemberson theonehandandthecompany on the other hand, and generally may decide any question necessary or expedient to be decided for rectification of the register.

(4) In the case of a company required by thisAct to send a list of its members to the Registrar, the Court when making an order for rectification of the register, shall by its order direct notice of the rectification to be given to the Registrar.

116. No notice of any trust, express, implied, or constructive, shall be entered on the register, or be receivable by the Registrar, in the case of companies registered in the Island.

117. The register of members shall be prima facie evidence of any matters by thisAct directed or authorized to be inserted therein.

Branch Register

118.—(1)Acompanyhavingasharecapitalwhichcarriesonbusiness in any country outside the Island may cause to be kept in that part of any such country in which it transacts business, a register of members resident in such part (in thisAct called a “branch register”).

Power of Court to rectify register.

Trusts not to be entered on register.

Register to be evidence.

Power for company to keep branch register.

85The Companies Act, 2004 [No. ]

(2)Thecompanyshallgive to theRegistrarnoticeof thesituation of the office where any branch register is kept and of any change in its situation, and if it is discontinued of its discontinuance, and any such notice shall be given within fourteen days of the opening of the office or of the change or discontinuance, as the case may be.

(3) If default is made in complying with subsection (2), the company and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

119.—(1) A branch register shall be deemed to be part of the company’s register of members (in this section called “the principal register”).

(2) The branch register shall be kept in the same manner in which the principal register is by thisAct required to be kept, except that the advertisement before closing the register shall be inserted in a newspaper circulating in the district where the branch register is kept, and that any competent court in the country where the register is kept may exercise the same jurisdiction of rectifying the register as is under thisAct exercisable by the Court.

(3) The company shall transmit to its registered office a copy of every entry in its branch register as soon as may be after the entry is made, and shall cause to be kept at the place where the company’s principal register is kept, duly entered up from time to time, a duplicate of its branch register and every such duplicate shall, for all the purposes of thisAct, be deemed to be part of the principal register.

(4) Subject to the provisions of this section with respect to the duplicate register, the shares registered in a branch register shall be distinguished from the shares registered in the principal register, and no transaction with respect to any shares registered in a branch register shall, during the continuance of that registration, be registered in any other register.

(5)Acompany may discontinue to keep a branch register, and thereupon all entries in that register shall be transferred to some other branch register kept by the company in the country concerned or to the principal register.

Regulations as to branch register.

[No. ] The Companies Act, 200486

(6) Subject to the provisions of thisAct, any company may, by itsarticles,makesuchprovisionsas itmaythinkfit respectingthekeeping of branch registers.

(7) If default is made in complying with subsection (3)—

(a) the company and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars; and

(b) where, by virtue of proviso (b) to subsection (2) of section 109, the principal register is kept at the office of some person other than the company and by reason of any default of that other person the company fails to comply with the requirements of subsection (3) of this section relating to the keeping of a duplicate of its branch register, he shall be liable to the same penalty as if he were an officer of the company who was in default.

(8)An instrument of transfer of a share registered in a branch register shall be deemed to be a transfer of property situated out of the Island, and unless executed in this Island, shall be exempt from stamp duty chargeable in the Island.

120. If by virtue of the law in force in any country, outside the Island companies incorporated under that law have power to keep in the Island branch registers of their members resident in the Island, the Minister may by order direct that sections 112 and 115 shall, subject to any modifications and adaptations specified in the order, apply to and in relation to any such branch registers kept in the Island as they apply to and in relation to the registers of companies within the meaning of this Act.

Annual Returns

121.—(1) Every company shall deliver to the Registrar successive annual returns each of which is made up to a date not later than the date which is from time to time the company's return date, that is—

(a) the anniversary of the company's incorporation; or

(b) if the company's last return delivered in accordance with this section was made up to a different date, the anniversary of that date.

Provisions as to branch registers of companies incorporated abroad kept in the Island.

Duty to deliver annual returns.

87The Companies Act, 2004 [No. ]

(2) Each return shall—

(a) be in the prescribed form as set out in the Fifth Schedule;

(b) contain the information required by or under the provisions of sections 122, 123 and 124 and shall be delivered to the Registrar within 28 days after the date to which it is made up.

(3) If a company fails to deliver an annual return in accordance with this section—

(a) that company shall be liable on default to a penalty of one hundred dollars for each day the default continues, subject to a maximum penalty of ten thousand dollars; and

(b) such penalty shall be payable to the Registrar.

122.—(1) Every company having a share capital shall make a return stating the date to which it is made up and containing a list of all persons who, on the date of the return, are members of the company, and of all persons who have ceased to be members since the date of the last return or, in the case of the first return, of the incorporation of the company.

(2) The list shall—

(a) state the names, addresses and occupations of all past and present members therein mentioned;

(b) state the number of shares held by each of the existing members at the date of the return, specifying shares transferred since the date of the last return or, in the case of thefirst return,of the incorporationof thecompanybypersons who have ceased to be members respectively and the dates of registration of the transfers; and

(c) if the names therein are not arranged in alphabetical order, have annexed to it an index sufficient to enable the name of any person in the list to be readily found:

Provided that, where the company has converted any of its shares into stock and given notice of the conversion to the Registrar, the list

Annual Return to be made by a company having share.

[No. ] The Companies Act, 200488

shall state the amount of stock held by each of the existing members instead of the amount of shares and the particulars relating to shares hereinbefore required.

(3) The return shall contain with respect to the registered office of the company, registers of members and debenture holders, shares and debentures indebtedness, and persons who are directors of the company, the matters specified in Part I of the Fifth Schedule and shall be in accordance with the form set out in Part II of that Schedule or as near thereto as circumstances permit.

(4) In the case of a company keeping a branch register, the particulars of the entries in that register shall, so far as they relate to matters which are required to be stated in the return, be included in the return made next after copies of those entries are received at the registered office of the company.

123.—(1) Every company not having a share capital shall make a return stating—

(a) the date to which it is made up;

(b) the address of the registered office of the company;

(c) all particulars with respect to the persons who at the date of the return are the directors of the company as are by thisAct required to be contained with respect to directors on the register of directors of a company.

(2) There shall be annexed to the return a statement containing particulars of the total indebtedness of the company in respect of all mortgages and charges which are required to be registered under this Act.

124.—(1) The annual return shall be contained in a separate part of the register of members.

(2) Section 111 shall apply to the annual return as it applies to the register of members.

(3) The annual return shall, in the case of every company which is not a private company and every private company which is obliged to

Annual Return to be made by a company not having a share capital.

General provisions as to annual return.

89The Companies Act, 2004 [No. ]

file accounts, include a written copy, certified by a director, the manager or secretary of the company to be a true copy, of the last balance sheet and profit and loss account laid before the company in general meeting, includingeverydocumentrequiredbylawtobeannexedthereto, together with a copy of the report of the auditors thereon certified as aforesaid, and if any such balance sheet is in a foreign language, there shall also be annexed to it a translation thereof in English, certified in the prescribed manner to be a correct translation:

Provided that, if the balance sheet did not comply with the requirements of the law as in force at the date of the audit with respect to the form of balance sheets, there shall be made such additions to and corrections in the copy as would have been required to be made in the balance sheet in order to make it comply with those requirements, and the fact that the copy has been so amended shall be stated thereon.

125. Aprivate company shall send with the annual return required by section 121—

(a) a certificate signed both by a director and by the secretary of the company that the company has not since the date of the last return, or since, in the case of a first return, the date of the incorporation of the company or, in the case of an existingcompanywhichbecameaprivatecompany, thedate on which it became a private company, issued any invitation to the public to subscribe for any shares or debentures of the company or to deposit money for fixed periods whether bearing or not bearing interest;

(b) where the annual return discloses the fact that the number of members of the company exceeds twenty, also a certificate so signed that the excess consists wholly of persons who under paragraph (b) of subsection (1) of section 25 are not to be included in reckoning the number of twenty;

(c) a certificate signed by the persons aforesaid that, to the best of theirknowledgeandbelief,nopersonother than theholder thereof except in cases provided for in theTwelfth Schedule has had any interest in any of the company’s shares since the

Certificates to be sent by private company with annual return.

Twelfth Schedule.

[No. ] The Companies Act, 200490

date of the last return or since, in the case of a first return, the date of the incorporation of the company or, in the case of an existing company which became a private company, the date on which it became a private company;

(d) where the company claims to be a private company which is notobliged tofileaccounts,acertificatesignedbythepersons aforesaid in the prescribed form.

Meetings and Proceedings

126.—(1) Every company shall in each year hold a general meeting as its annual general meeting in addition to any other meetings in that year, and shall specify the meeting as such in the notices calling it; and notmore thanfifteenmonthsshall elapsebetween thedateofoneannual general meeting of a company and that of the next:

Provided that, so long as a company holds its first annual general meetingwithineighteenmonthsof its incorporation, itneednothold it in the year of its incorporation or in the following year.

(2) If default is made in holding a meeting of the company in accordance with subsection (1), the Minister may, on the application of any member of the company, call, or direct the calling of, a general meeting of the company and give such ancillary or consequential directions as he may think expedient, including directions modifying or supplementing, in relation to the calling, holding and conducting of the meeting, theoperationof thecompany’sarticles;andit isherebydeclared that the directions that may be given under this subsection include a direction that one member of the company present in person or by proxy shall be deemed to constitute a meeting.

(3)Ageneral meeting held in pursuance of subsection (2) shall, subject to any directions of the Minister be deemed to be an annual general meeting of the company; but, where a meeting so held is not held in the year in which the default in holding the company’s annual general meeting occurred, the meeting so held shall not be treated as the annual general meeting for the year in which it is held unless at that meeting the company resolves that it shall be so treated.

Annual general meeting.

91The Companies Act, 2004 [No. ]

(4) Where a company resolves that a meeting shall be so treated, acopyof theresolutionshall,withinfifteendaysafter thepassingthereof, be forwarded to the Registrar and recorded by him.

(5) If default is made in—

(a) holding a meeting of the company in accordance with subsection (1); or

(b) complying with any directions of the Minister under subsection (2);

(c) complying with subsection (4),

the company and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

127.—(1) Every company limited by shares and every company limited by guarantee and having a share capital shall, within a period of not less than one month nor more than three months from the date at which the company is entitled to commence business, hold a general meeting of the members of the company, which shall be called “the statutorymeeting”.

(2) The directors shall, at least seven days before the day on which the meeting is held, forward a report (in thisAct referred to as “the statutory report”) to every member of the company.

(3) The statutory report shall be certified by not less than two directors of the company or where there are less than two directors, by the sole director and shall state—

(a) the total number of shares allotted, distinguishing shares allotted as fully or partly paid up otherwise than in cash, and stating in the case of shares partly paid up the extent to which they are so paid up, and in either case, the consideration for which they have been allotted;

(b) the total amount of cash received by the company in respect of all the shares allotted, distinguished as aforesaid;

(c) an abstract of the receipts of the company and of the payments made thereout, up to a date within seven days of

Statutory meeting and statutory report.

[No. ] The Companies Act, 200492

the date of the report, exhibiting under distinctive headings the receipts of the company from shares and debentures and other sources, the payments made thereout, and particulars concerning thebalance remaining inhand, andan account or estimate of the preliminary expenses of the company;

(d) the names, addresses and descriptions of the directors, auditors, if any, managers, if any, and secretary of the company; and

(e) the particulars of any contract the modification of which is to be submitted to the meeting for its approval, together with the particulars of the modification or proposed modification.

(4) The statutory report shall, so far as it relates to the shares allotted by the company, and to the cash received in respect of such shares, and to the receipts and payments of the company on capital account, be certified as correct by the auditors, if any, of the company.

(5) The directors shall cause a copy of the statutory report, certified as required by this section, to be delivered to the Registrar for registration forthwith after the sending thereof to the members of the company.

(6) The directors shall cause a list showing the names, descriptions and addresses of the members of the company, and the number of shares held by them respectively, to be produced at the commencement of the meeting and to remain open and accessible to any member of the company during the continuance of the meeting.

(7) The members of the company present at the meeting shall be at liberty to discuss any matter relating to the formation of the company, or arising out of the statutory report, whether previous notice has been given or not, but no resolution of which notice has not been given in accordance with the articles may be passed.

(8) The meeting may adjourn from time to time, and at any adjourned meeting any resolution of which notice has been given in accordance with the articles, either before or subsequent to the former meeting, may be passed, and the adjourned meeting shall have the same powers as an original meeting.

93The Companies Act, 2004 [No. ]

(9) In the event of any default in complying with the provisions of this section, every director of the company who is knowingly and wilfully guilty of the default or, in the case of default by the company, every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

(10) This section shall not apply to a private company.

128.—(1) The directors of a company, notwithstanding anything in its articles, shall, on the requisitionofmembersof thecompanyholding, at the date of the deposit of the requisition, not less than one-tenth of such of the paid up capital of the company, as at the date of the deposit, which carries the right of voting at general meetings of the company, or, in the case of a company not having a share capital, members of the company representing not less than one-tenth of the total voting rights of all the members having at that date a right to vote at general meetings of the company, forthwith proceed duly to convene an extraordinary general meeting of the company.

(2) The requisition shall state the objects of the meeting, and shall be signed by the requisitionists and deposited at the registered office of the company, and may consist of several documents in like form, each signed by one or more requisitionists.

(3) If the directors do not within twenty-one days from the date of the deposit of the requisition proceed duly to convene a meeting, the requisitionists, or any of them representing more than one-half of the totalvoting rightsofallof them,may themselvesconveneameeting,but any meeting so convened shall not be held after the expiration of three months from that date.

(4)Ameeting convened under this section by the requisitionists shall be convened in the same manner, as nearly as possible, as that in which meetings are to be convened by directors.

(5)Any reasonable expenses incurred by the requisitionists by reason of the failure of the directors duly to convene a meeting shall be repaid to the requisitionists by the company, and any sum so repaid shall be retained by the company out of any sums due or to become due from the company by way of fees or other remuneration in respect of their services to such of the directors as were in default.

Convening of extraordinary general meeting on requisition.

[No. ] The Companies Act, 200494

(6) For the purposes of this section the directors shall, in the case of a meeting at which a resolution is to be proposed as a special resolution, be deemed not to have duly convened the meeting if they do not give such notice thereof as required by section 138.

129.—(1)Any provision of a company’s articles shall be void in so far as it provides for the calling of a meeting of the company, (other than an adjourned meeting) by a shorter notice than—

(a) in the case of the annual general meeting, twenty-one days’ notice in writing; and

(b) in the case of a meeting other than an annual general meeting or a meeting for the passing of a special resolution, fourteen days’ notice in writing in the case of a company other than an unlimited company and seven days’ notice in writing in the case of an unlimited company.

(2) Save in so far as the articles of a company make other provision in that behalf (not being a provision avoided by subsection (1)) a meeting of the company (other than an adjourned meeting) may be called—

(a) in thecaseof theannualgeneralmeetingby twenty-onedays’ notice in writing; and

(b) in the case of a meeting other than an annual general meeting orameetingfor thepassingofaspecial resolution,byfourteen days’ notice in writing in the case of a company other than anunlimitedcompanyandbysevendays’notice inwriting in the case of an unlimited company.

(3)Ameetingofacompanyshall,notwithstanding that it iscalled byshorternotice than that specified insubsection(2)or in thecompany’s articles, as the case may be, be deemed to have been duly called if it is so agreed—

(a) in the case of a meeting called as the annual general meeting, by all the members entitled to attend and vote thereat; and

(b) in the case of any other meeting, by a majority in number of the members having a right to attend and vote at the meeting, being a majority, together holding not less than ninety-five

Length of notice for calling meetings.

95The Companies Act, 2004 [No. ]

per centum in value of the shares giving a right to attend and vote at the meeting, or, in the case of a company not having a share capital, together representing not less than ninety- five per centum of the total voting rights at that meeting of all the members.

130.—(1) The following provisions shall have effect in so far as the articles of the company do not make other provision in that behalf—

(a) notice of the meeting of a company shall be served on every member of the company in the manner in which notices are required to be served by TableA and for the purpose of this paragraph the expression “TableA” means that Tables as for the time being in force;

(b) two or more members holding not less than one-tenth of the issued share capital or, if the company has not a share capital, not less than five per centum in number of the members of the company may call a meeting;

(c) in the case of a private company two members, and in the case of any other company three members, personally present shall be a quorum;

(d) any member elected by the members present at a meeting may be chairman thereof;

(e) in the case of a company originally having a share capital, every member shall have one vote in respect of each share or each thousand dollars of stock held by him, and in any other case every member shall have one vote.

(2) If for any reason it is impracticable to call a meeting of a company in any manner in which meetings of that company may be called,or toconduct themeetingof thecompany inamannerprescribed in the Company's articles, the Court may, either of its own motion or on the application of any director of the company or of any member of the company who would be entitled to vote at the meeting, order a meeting

General provisions as to meetings and votes.

[No. ] The Companies Act, 200496

of the company to be called, held and conducted in such manner as the Court thinks fit, and where any such order is made may give such ancillary or consequential directions as it thinks expedient, and any meeting called, held and conducted in accordance with any such order shall for all purposes be deemed to be a meeting of the company duly called, held and conducted.

(3) It is hereby declared that the directions that may be given undersubsection(2) includeadirection thatonememberof thecompany present in person or by proxy shall be deemed to constitute a meeting.

(4) Where by any provision contained in thisAct special notice is required of a resolution, the resolution shall not be effective unless notice of the intention to move it has been given to the company not less than twenty-eight days before the meeting at which it is moved, and the company shall give its members notice of any such resolution at the same time in the same manner as it gives notice of the meeting or, if that isnotpracticable, shallgive themnotice thereof, eitherbyadvertisement in a newspaper having an appropriate circulation or in any other mode allowedbythearticles,not less than twenty-onedaysbefore themeeting:

Provided that if, afternoticeof the intention tomovesucha resolution has been given to the company, a meeting is called for a date twenty- eight days or less after the notice has been given, the notice, though not given within the time required by this subsection, shall be deemed to have been properly given for the purposes thereof.

131.—(1)Any member of a company entitled to attend and vote at a meeting of the company shall be entiled to appoint another person (whether a member or not) as his proxy to attend and vote instead of him, and a proxy appointed to attend and vote instead of a member (or, where more than one proxy has been so appointed, one of their number named by the member for the purpose) shall also have the same right as the member to speak at the meeting:

Provided that, unless the articles otherwise provide—

(a) this subsection shall not apply in the case of a company not having a share capital; and

Proxies.

97The Companies Act, 2004 [No. ]

(b) a member shall not be entitled to appoint more than one proxy to attend on the same occasion; and

(c) a proxy shall not be entitled to vote except on a poll.

(2) In every notice calling a meeting of a company having a share capital there shall appear with reasonable prominence a statement that a member entitled to attend and vote is entitled to appoint a proxy to attend and vote instead of him, and that a proxy need not also be a member and if default is made in complying with this subsection as respects any meeting, every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

(3)Any provision contained in a company’s articles shall be void in so far as it would have the effect of requiring the instrument appointingaproxy,oranyotherdocumentnecessary toshowthevalidity or otherwise relating to the appointment of a proxy, to be received by the company or any other person more than forty-eight hours before a meeting or adjourned meeting in order that the appointment may be effective there at.

(4) Where any such instruments or documents appointing or relating to proxies as are mentioned in subsection (3) are received by or on behalf of a company, any person entitled, in his own right or as proxy for another member or members or partly in one way and partly in another to more than ten per centum of the total voting rights of all the members having a right to vote at the meeting or adjourned meeting affected, and also any person authorized in writing in that behalf by any person, or by any number of persons together, so entitled, shall have the right, at any time during business hours prior to the conclusion of the meeting but subject to such reasonable restrictions as the company may impose, to inspect such instruments or documents.

(5) If for the purpose of any meeting of a company invitations to appoint as proxy a person or one of a number of persons specified in the invitations are issued at the company’s expense—

(a) to some only of the members entitled to be sent a notice of the meeting and to vote thereat by proxy; or

(b) without being accompanied by forms for the appointment of a proxy which entitle the members to direct the proxy to vote either for or against each resolution,

[No. ] The Companies Act, 200498

every officer of the company who knowingly and wilfully authorizes or permits their issue as aforesaid shall be liable to a fine not exceeding fifty thousanddollars:

Provided that an officer shall not be liable under this subsection by reason only of the issue to a member at his request in writing of a form of appointment naming the proxy or of a list of persons willing to act as proxyif theformor list isavailableonrequest inwriting toeverymember entitled to vote at the meeting by proxy.

(6) This section shall apply to meetings of any class of members of a company as it applies to general meetings of the company.

132.—(1) Any provision contained in a company’s articles shall be void in so far as it would have the effect either—

(a) of excluding the right to demand a poll at a general meeting on any question other than the election of the chairman of the meeting or the adjournment of the meeting; or

(b) of making ineffective a demand for a poll on any such question which is made either—

(i) by not less than five members having the right to vote at the meeting; or

(ii) by a member or members representing not less than one-tenth of the total voting rights of all the members having the right to vote at the meeting; or

(iii) by a member or members holding shares in the company, being shares on which an aggregate sum has been paid up equal to not less than one-tenth of the total sum paid up on all the shares conferring that right; or

(iv) by a member holding shares in the company as a trusteeofanapprovedemployeeshareownership plan as defined in section 2 of the Employees Share Ownership Plan Act, being shares conferring a right to vote at the meeting.

Right to demand a poll.

99The Companies Act, 2004 [No. ]

(2) The instrument appointing a proxy to vote at a meeting of a company shall be deemed also to confer authority to demand or join in demanding a poll, and for the purposes of subsection (1) a demand by a person as proxy for a member shall be the same as a demand by the member.

133. On a poll taken at a meeting of a company or a meeting of any class of members of a company, a member entitled to more than one vote need not, if he votes, use all his votes or cast all the votes he uses in the same way.

134.—(1) Acorporation, whether a company within the meaning of thisAct or not may—

(a) if it is a member of another corporation, being a company within the meaning of thisAct, by resolution of its directors or other governing body authorize such person as it thinks fit to act as its representative at any meeting of the company or at any meeting of any class of members of the company;

(b) if it is acreditor (includingaholderofdebentures)of another corporation, being a company within the meaning of this Act, by resolution of its directors or other governing body, authorizesuchpersonas it thinks fit toactas its representative at any meeting of any creditors of the company held in pursuance of thisAct or of any rules made thereunder, or in pursuance of the provisions contained in any debenture or trust deed, as the case may be.

(2) Apersonauthorizedasaforesaidshallbeentitled to exercise the same powers on behalf of the corporation which he represents as that corporation could exercise if it were an individual shareholder, creditor, or holder of debentures, of that other company.

135.—(1) A company shall at its own expense on the request in writing of any member entitled to attend and vote at an annual general meeting, include in the notice of that annual general meeting notice of any resolution consisting of not more than five hundred words which may properly be moved and is intended to be moved at that meeting:

Voting on a poll.

Representation of companies at meetings of other companies and of creditors.

Circulation of members' resolutions.

[No. ] The Companies Act, 2004100

Provided that if the proposed resolution is not passed at that meeting the same resolution or one substantially to the same effect shall not be movedatanyannualgeneralmeetingwithin three years thereafterunless the directors shall otherwise agree or unless the request within three years is supported in writing by members of the company representing between them not less than one-twentieth of the total voting rights of all the members having at the date of the request a right to vote on the resolution to which the request relates.

(2) Acompany shall not be bound to give notice of any such resolution unless the written request or requests, signed by the member or members concerned, together with the resolution are deposited at the registered office of the company not less than six weeks before the meeting:

Provided that if, after any such resolution has been deposited, an annual general meeting is called for a date six weeks or less thereafter, the resolution shall be deemed to have been properly deposited.

136.—(1) Acompany shall, at the request in writing of any member entitled to attend and vote at an annual general meeting but (unless the company otherwise resolves or section 135 applies) at the expense of thatmember,circulate tomembersof thecompany astatement (whether in the form of a resolution or not) of not more than one thousand words with respect to any business to be dealt with at that meeting.

(2) Such a statement shall be circulated to members of the company in any manner permitted for service of notice of the annual general meeting, and, so far as practicable, at the same time as notice of the meeting, or, if that is impracticable, as soon as possible after the circulation of such notice.

(3) Acompany shall not be bound to circulate such a statement unless—

(a) the written request, signed by the member concerned, together with the statement, is deposited at the registered office of the company not less than ten days before the meeting;and

Circulation of members' circulars.

101The Companies Act, 2004 [No. ]

(b) there is also deposited with the request a sum reasonably sufficient to meet the company’s expenses in giving effect thereto.

137.—(1) Acompany shall not be bound under either section 135 or section 136 to circulate any resolution or statement if, on the application either of the company or of any other person who claims to be aggrieved, the Court is satisfied that the rights conferred by those sections are being abused to secure needless publicity for defamatory matter; and the Court may order the company’s costs on an application under this section to be paid in whole or in part by the member making the request, notwithstanding that he is not a party to the application.

(2) In the event of any default in complying with section 135 or section 136, every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

138.—(1)Aresolution shall be an extraordinary resolution when it has been passed by a majority of not less than three-fourths of such members as, being entitled so to do, vote in person or, where proxies are allowed, by proxy, at a general meeting of which notice specifying the intention to propose the resolution as an extraordinary resolution has been duly given.

(2) Aresolution shall be a special resolution when it has been passed by such a majority as is required for the passing of an extraordinary resolution and at a general meeting of which not less than twenty-one days’ notice, specifying the intention to propose the resolution as a special resolution, has been duly given:

Provided that, if ninety-five per centum of the members entitled to attend and vote at any such meeting so agree, a resolution may be proposed and passed as a special resolution at a meeting of which less than twenty-one days’ notice has been given.

(3) At any meeting at which an extraordinary resolution or a special resolution is submitted to be passed, a declaration of the chairman that the resolution is carried shall, unless a poll is demanded, be conclusive evidence of the fact without proof of the number or proportion of the votes recorded in favour of or against the resolution.

Provisions as to extra- ordinary and special resolutions.

General provisions affecting sections 135 and 136.

[No. ] The Companies Act, 2004102

(4)At any meeting at which an extraordinary resolution or a special resolution is submitted to be passed a poll shall be taken to be effectively demanded, if demanded—

(a) bysuchnumberofmembers for the timebeingentitled under the articles to vote at the meeting as may be specified in the articles, so,however, that it shallnot in anycasebenecessary for more than five members to make the demand; or

(b) if no provision is made by the articles with respect to the right to demand the poll, by three members so entitled or by one member or two members so entitled, if that member holdsor those twomembers togetherholdnot less thanfifteen per centum of the paid up share capital of the company.

(5) When a poll is demanded in accordance with this section, incomputingthemajorityonthepoll referenceshallbehadtothenumber of votes to which each member is entitled by virtue of thisAct or of the articles of the company.

(6) For the purposes of this section, notice of a meeting shall be deemed to be duly given and the meeting to be duly held when the notice is given and the meeting held in manner provided by thisAct or articles.

139.—(1) Acopy of every resolution or agreement to which this section applies shall, within fifteen days after the passing or making thereof, be forwarded to the Registrar and recorded by him.

(2) Where articles have been registered, a copy of every such resolution or agreement for the time being in force shall be embodied in or annexed to every copy of the articles issued after the passing of the resolution or the making of the agreement.

(3) Where articles have not been registered, a copy of every such resolution or agreement shall be forwarded to any member at his request, on payment of fifty dollars or such less sum as the company may direct.

(4) This section shall apply to—

(a) special resolutions;

Registration and copies of certain resolutions and agreements.

103The Companies Act, 2004 [No. ]

(b) extraordinary resolutions;

(c) resolutions which have been agreed to by all the members of a company, but which, if not so agreed to, would not have been effective for their purpose unless, as the case may be, theyhadbeenpassedasspecial resolutionsorasextraordinary resolutions;

(d) resolutions or agreements which have been agreed to by all the members of some class of shareholders, but which, if not so agreed to, would not have been effective for their purpose unless they had been passed by some particular majority or otherwise in some particular manner, and all resolutions or agreements which effectively bind all the members of any class of shareholders though not agreed to by all those members;

(e) resolutions requiringacompany tobewoundup voluntarily, passed under paragraph (a) of subsection (1) of section 272.

(5) Ifacompanyfails tocomplywithsubsection (1) thecompany and every officer of the company who is in default shall be liable to a default fine of fifty thousand dollars.

(6) If a company fails to comply with subsection (2) or subsection (3) the company and every officer of the company who is in default shall be liable to a fine not exceeding one thousand dollars for each copy in respect of which default is made.

(7) For the purposes of subsections (5) and (6) a liquidator of the company shall be deemed to be an officer of the company.

140. Where after the appointed day a resolution is passed at an adjourned meeting of—

(a) a company;

(b) the holders of any class of shares in a company;

(c) the directors of a company,

the resolution shall for all purposes be treated as having been passed on the date on which it was in fact passed, and shall not be deemed to have been passed on any earlier date.

Resolutions passed at adjourned meetings.

[No. ] The Companies Act, 2004104

141.—(1) Unless the articles of a company otherwise provides, a director may if all the directors of the company consent, participate in a meeting of directors of the company or of a committee of the directors by means of such telephone or other communicating facilities as permit all persons participating in the meeting to hear each other.

(2) A director who participates in a meeting of directors by such means as are described in subsection (1), is, for the purposes of thisAct, present at the meeting, and unless the articles so provide, shall count to constitute a quorum.

(3) For the purposes of this section, the laws of Jamaica shall apply to any meeting of directors of a company incorporated in Jamaica and the meeting is deemed to take place in Jamaica.

142.—(1) Every company shall cause minutes of all proceedings of generalmeetings, all proceedingsatmeetingsof itsdirectors and,where there are managers, all proceedings at meetings of its managers, to be entered in books kept for the purpose.

(2) Any such minute if purporting to be signed by the chairman of the meeting at which the proceedings were had, or by the chairman of the next succeeding meeting, shall be evidence of the proceedings.

(3) Where minutes have been made in accordance with the provisions of this section of the proceedings at any general meeting of thecompanyormeetingofdirectorsormanagers, then, until thecontrary is proved, the meeting shall be deemed to have been duly held and convened, and all proceedings had thereat to have been duly had, and all appointments of directors, managers, or liquidators, shall be deemed to be valid.

(4) If a company fails to comply with subsection (1), the company and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

143.—(1) The books containing the minutes of proceedings of any general meeting of a company held after the appointed day shall be kept at the registered office of the company, and shall during business hours (subject to such reasonable restrictions as the company may by its articles or in general meeting impose, so that not less than two hours

Minutes of proceedings of meetings of company and of directors and managers.

Inspection of minute books.

Participation by electronic means.

105The Companies Act, 2004 [No. ]

in each day be allowed for inspection) be open to the inspection of any member without charge.

(2) Any member shall be entitled to be furnished within seven days after he has made a request in that behalf to the company with a copy of any such minutes as aforesaid at a charge not exceeding fifty dollars for every hundred words.

(3) If any inspection required under this section is refused or if any copy required under this section is not sent within the proper time, the company and every officer of the company who is in default shall be liable in respectof eachoffence toa finenot exceeding two thousand dollars and further to a default fine of fifty thousand dollars.

(4) In the case of any such refusal or default, the Court may by order compel an immediate inspection of the books in respect of all proceedings of general meetings or direct that the copies required shall be sent to the persons requiring them.

Accounts and Audit

144.—(1) Every company shall cause to be kept proper books and documents of account with respect to—

(a) all sums of money received and expended by the company andthematters inrespectofwhichthereceiptandexpenditure takes place;

(b) all sales and purchases of goods by the company;

(c) the assets and liabilities of the company.

(2) For the purposes of subsection (1), proper books and documents of account shall not be deemed to be kept with respect to the matters aforesaid if there are not kept such books and documents asarenecessary togivea trueandfairviewof thestate of thecompany’s affairs and to explain its transactions.

(3) Subject to the provisions of subsection (4) relating to books anddocumentsofaccountkeptoutside the Island,books anddocuments of account shall be kept at the registered office of the company or at such other place as the directors think fit, and shall at all times be open to inspection by the directors.

Books and documents of account.

[No. ] The Companies Act, 2004106

(4) If books and documents of account are kept at a place outside the Island there shall be sent to, and kept at a place in the Island and be at all times open to inspection by the directors such accounts and returns with respect to the business dealt with in the books and documents of account so kept as will disclose with reasonable accuracy the financialpositionof thatbusinessat intervalsnotexceeding six months and will enable to be prepared in accordance with thisAct the company’s balance sheet, its profit and loss account or income and expenditure account, and any document annexed to any of those documentsgivinginformationwhichisrequiredbythisActandis thereby allowed to be so given:

Provided that the Minister, if, having regard to the nature andvolume of the business done in the Island by any company, he is satisfied that it is just to do so, may by order grant, subject to such conditions as may bespecified in theorder, exemption fromanyof theobligations imposed by this subsection.

(5) If any person being a director of a company fails to take all reasonable steps to secure compliance by the company with the requirements of this section, or has by his own wilful act been the cause of any default by the company thereunder, he shall, in respect of each offence, be liable on summary conviction before a Resident Magistrate to imprisonment with or without hard labour for a term not exceeding six months or to a fine not exceeding fifty thousand dollars:

Provided that—

(a) in any proceedings against a person in respect of an offence under this section consisting of a failure to take reasonable steps to secure compliance by the company with the requirements of this section, it shall be a defence to prove that he had reasonable ground to believe and did believe that a competent and reliable person was charged with the duty of seeing that those requirements were complied with and was in a position to discharge that duty; and

(b) a person shall not be sentenced to imprisonment for such an offence unless, in the opinion of the Court dealing with the case, the offence was committed wilfully.

107The Companies Act, 2004 [No. ]

145.—(1) The directors of every company shall, at some date not later than eighteen months after the incorporation of the company and subsequentlyat leastonce ineverycalendaryear, laybefore thecompany in general meeting a profit and loss account or, in the case of a company not trading forprofit, an incomeandexpenditure account for theperiod, in the case of the first account, since the incorporation of the company, and, in any other case, since the preceding account, made up to a date not earlier than the date of the meeting by more than nine months, or, in the case of a company carrying on business or having interests abroad by more than twelve months:

Provided that the Minister, if for any special reason he thinks fit so to do, may, in the case of any company, extend the period of eighteen months aforesaid, and in the case of any company and with respect to any year extend the periods of nine and twelve months aforesaid.

(2) The directors shall cause to be made out in every calendar year, and to be laid before the company in general meeting, a balance sheet as at the date to which the profit and loss account, or the income and expenditure account, as the case may be, is made up and there shall be attached to every such balance sheet a report by the directors with respect to the state of the company’s affairs, the amount, if any, which they recommend should be paid by way of dividend, and the amount, if any, which they propose to carry to the reserve fund, general reserve or reserve account shown specifically on the balance sheet, or to a reserve fund, general reserve or reserve account to be shown specifically on a subsequent balance sheet.

(3) If any person being a director of a company fails to take all reasonable steps to comply with the provisions of this section, he shall, in respect of each offence, be liable on summary conviction before a Resident Magistrate to imprisonment with or without hard labour for a term not exceeding six months or to a fine not exceeding fifty thousand dollars:

Provided that—

(a) in any proceedings against a person in respect of an offence under this section, it shall be a defence to prove that he had

Profit and loss account and balance sheet.

[No. ] The Companies Act, 2004108

reasonablegroundtobelieveanddidbelieve thatacompetent and reliable person was charged with the duty of seeing that the provisions of this section were complied with and was in a position to discharge that duty; and

(b) a person shall not be sentenced to imprisonment for such an offence unless, in the opinion of the Court dealing with the case, the offence was committed wilfully.

146.—(1) Subject to the provisions of the Seventh Schedule, the accounts of a company shall give a true and fair view of the state of affairs of the company as at the end of its financial year.

(2) The accounts of a company shall comply with the requirements of the Seventh Schedule, so far as applicable thereto.

(3) Save as expressly provided in the following provisions of this section or in the Seventh Schedule the requirements of section 145 and theSeventhScheduleshallbewithoutprejudiceeither to thegeneral requirements of subsection (1) or to any other requirements of thisAct.

(4) The Minister may, on the application or with the consent of a company’s directors, modify in relation to that company any of the requirements of thisAct as to the matters to be stated in a company’s balance sheet or profit and loss account (except the requirements of subsection (1)) for the purpose of adapting them to the circumstances of the company.

(5) Subsections (1) and (2) shall not apply to a company’s profit and loss account if—

(a) the company has subsidiaries; and

(b) the profit and loss account is framed as a consolidated profit and loss account dealing with all or any of the company’s subsidiaries as well as the company and—

(i) complieswith therequirementsof thisAct relating to consolidated profit and loss accounts; and

(ii) shows how much of the consolidated profit or loss for the financial year is dealt with in the accounts of the company.

General provisions as to content and form of accounts.

109The Companies Act, 2004 [No. ]

(6) If any person being a director of a company fails to take all reasonable steps to secure compliance as respects any accounts laid before thecompanyingeneralmeetingwith theprovisionsof thissection and with the other requirements of this Act as to the matters to be stated in accounts, he shall, in respect of each offence, be liable on summaryconvictionbeforeaResidentMagistrate to imprisonmentwith or without hard labour for a term not exceeding six months or to a fine not exceeding fifty thousand dollars:

Provided that—

(a) in any proceedings against a person in respect of an offence under this section, it shall be a defence to prove that he had reasonablegroundtobelieveanddidbelieve thatacompetent and reliable person was charged with the duty of seeing that those provisions or those other requirements, as the case may be, were complied with and was in a position to discharge that duty; and

(b) a person shall not be sentenced to imprisonment for any such offence unless, in the opinion of the Court dealing with the case, the offence was committed wilfully.

(7) For the purposes of this section and the followingprovisions of thisAct, except where the context otherwise requires—

(a) any reference to a balance sheet or profit and loss account shall include any notes thereon or document annexed thereto givinginformationwhichisrequiredbythisActandis thereby allowed to be so given; and

(b) any reference to a profit and loss account shall be taken, in the case of a company not trading for profit, as referring to its income and expenditure account, and references to profit or to loss and, if the company has subsidiaries, references to a consolidated profit and loss account shall be construed accordingly.

147.—(1) Where at the end of its financial year a company has subsidiaries, accounts or statements (in thisAct referred to as “group accounts”) dealing as hereinafter mentioned with the stateof affairs and profit or loss of the company and the subsidiaries shall, subject to

Obligation to lay group accounts before holding company.

[No. ] The Companies Act, 2004110

subsection (2), be laid before the company in general meeting when the company’s own balance sheet and profit and loss account are so laid.

(2) Notwithstanding anything in subsection (1)—

(a) group accounts shall not be required where the company is at the end of its financial year the wholly owned subsidiary of another body corporate incorporated in the Island; and

(b) groupaccountsneednotdealwithasubsidiaryofthecompany if the company’s directors are of opinion that—

(i) it is impracticable, or would be of no real value to members of the company, in view of the insignificant amounts involved, or would involve expense or delay out of proportion to the value to members of the company; or

(ii) the result would be misleading, or harmful to the businessof thecompanyoranyof its subsidiaries; or

(iii) the business of the holding company and that of the subsidiary are so different that they cannot reasonably be treated as a single undertaking,

and, if the directors are of such an opinion about each of the company’ssubsidiaries,groupaccountsshallnotbe required:

Provided that the approval of the Minister shall be required for not dealing in group accounts with a subsidiary on the ground that the result wouldbeharmfuloronthegroundof thedifferencebetweenthebusiness of the holding company and that of the subsidiary.

(3) If any person being a director of a company fails to take all reasonable steps to secure compliance as respects the company with the provisions of this section, he shall, in respect of each offence, be liable on summary conviction before a Resident Magistrate to imprisonment with or without hard labour for a term not exceeding six months or to a fine not exceeding fifty thousand dollars:

Provided that—

(a) in any proceedings against a person in respect of an offence under this section, it shall be a defence to prove that he had

111The Companies Act, 2004 [No. ]

reasonablegroundtobelieveanddidbelieve thatacompetent and reliable person was charged with the duty of seeing that the requirements of this section were complied with and was in a position to discharge that duty; and

(b) apersonshallnotbesentencedtoimprisonmentforanoffence under this section unless, in the opinion of the Court dealing with the case, the offence was committed wilfully.

(4) For the purposes of this section a body corporate shall be deemed to be the wholly owned subsidiary of another if it has no members except that other and that other’s wholly owned subsidiaries and its or their nominees.

148.—(1) Subject to subsection (2), the group accounts laid before a holding company shall be consolidated accounts comprising—

(a) a consolidated balance sheet dealing with the state of affairs of the company and all the subsidiaries to be dealt with in group accounts;

(b) a consolidated profit and loss account dealing with the profit or loss of the company and those subsidiaries.

(2) If the company’s directors are of opinion that it is better for the purpose—

(a) of presenting the same or equivalent information about the state of affairs and profit or loss of the company and those subsidiaries; and

(b) of so presenting it that it may be readily appreciated by the company’s members,

the group accounts may be prepared in a form other than that required by subsection (1), and in particular may consist of more than one set of consolidated accounts dealing respectively with the company and one groupof subsidiariesandwithothergroupsof subsidiariesorof separate accountsdealingwitheachof thesubsidiaries,orofstatementsexpanding the information about the subsidiaries in the company’s own accounts, or any combination of those forms.

Form of group accounts.

[No. ] The Companies Act, 2004112

(3) The group accounts may be wholly or partly incorporated in the company’s own balance sheet and profit and loss account.

149.—(1) The group accounts laid before a company shall give a true and fair view of the state of affairs and profit or loss of the company and the subsidiaries dealt with thereby as a whole, so far as concerns members of the company.

(2) Where the financial year of a subsidiary does not coincide with that of the holding company, the group accounts shall, unless the Ministeron theapplicationorwith theconsentof theholdingcompany’s directors otherwise directs, deal with the subsidiary’s state of affairs as at the end of its financial year ending with or last before that of the holdingcompany,andwith thesubsidiary’sprofitor lossfor that financial year.

(3) Without prejudice to subsection (1), the group accounts, if prepared as consolidated accounts, shall comply with the requirements of the Seventh Schedule so far as applicable thereto, and if not so prepared shall give the same or equivalent information:

Provided that the Minister may, on the application or with the consent of a company’s directors, modify those requirements in relation to that company for the purpose of adapting them to the circumstances of the company.

150.—(1) A holding company’s directors shall secure that except where in their opinion there are good reasons against it, the financial year of each of its subsidiaries shall coincide with the company’s own financialyear.

(2) Where it appears to the Minister desirable for a holding company or a holding company’s subsidiary to extend its financial year so that the subsidiary’s financial year may end with that of the holding company,andfor thatpurpose topostpone thesubmissionof the relevant accounts to a general meeting from one calendar year to the next, the Minister may on the application or with the consent of the directors of the company whose financial year is to be extended direct that, in the case of that company, the submission of accounts to a general meeting, the holding of an annual general meeting or the making of an annual return shall not be required in the earlier of those calendar years.

Contents of group accounts.

Seventh Schedule.

Financial year of holding company and subsidiary.

113The Companies Act, 2004 [No. ]

151.—(1) For the purposes of thisAct, a company shall, subject to theprovisionsof subsection (3), bedeemed tobeasubsidiary ofanother if, butonly if—

(a) that other either—

(i) is a member of it and controls the composition of its board of directors; or

(ii) holds more than half in value of its equity share capital; or

(b) the firstmentioned company is a subsidiary of any company which is that other’s subsidiary.

(2) For the purposes of subsection (1), the composition of a company’s board of directors shall be deemed to be controlled by another company, if, but only if, that other company by the exercise of some power exercisable by it without the consent or concurrence of any other person can appoint or remove the holders of all or a majority of the directorships; but for the purposes of this provision that other company shall be deemed to have power to appoint to a directorship with respect to which any of the following conditions is satisfied, that is to say—

(a) thatapersoncannotbeappointed theretowithout theexercise in his favour by that other company of such a power as aforesaid; or

(b) that aperson’s appointment thereto followsnecessarily from his appointment as director of that other company; or

(c) that the directorship is held by that other company itself or by a subsidiary of it.

(3) In determining whether one company is a subsidiary of another—

(a) any shares held or power exercisable by that other in a fiduciary capacity shall be treated as not held or exercisable by it;

Meaning of "holding company" and "subsidiary".

[No. ] The Companies Act, 2004114

(b) subject to paragraphs, (c) and (d) any shares held or power exercisable—

(i) by any person as a nominee for that other (except where that other is concerned only in a fiduciary capacity); or

(ii) by, or by a nominee for, a subsidiary of that other, not being a subsidiary which is concerned only in a fiduciary capacity, shall be treated as held or exercisable by that other;

(c) any shares held or power exercisable by any person by virtue of the provisions of any debentures of the first mentioned company or of a trust deed for securing any issue of such debentures shall be disregarded;

(d) any shares or power exercisable by, or by a nominee for, that other or its subsidiary (not being held or exercisable as mentioned in paragraph (c)) shall be treated as not held or exercisable by that other if the ordinary businessof that other or its subsidiary, as the case may be, includes the lending of money and the shares are held or power is exercisable as aforesaid by way of security only for the purposes of a transaction entered into in the ordinary course of that business.

(4) For the purpose of thisAct, a company shall be deemed to be another’s holding company if, but only if, that other is its subsidiary.

(5) In this section the expression “company” includes any body corporate, and the expression “equity share capital” means, in relation to a company, its issued share capital excluding any part thereof which, neither as respects dividends nor as respects capital, carries any rights to participate beyond a specified amount in a distribution.

152.—(1) Every balance sheet of a company shall be signed on behalf of the board by two of the directors of the company or, if there is only one director, by that director.

Requirements relating to balance sheets.

115The Companies Act, 2004 [No. ]

(2) In the case of a banking company the balance sheet shall be signed by the secretary and where there are more than three directors of the company by at least three of those directors, and where there are not more than three directors by all directors.

(3) The profit and loss account and, so far as not incorporated in the balance sheet or profit and loss account, any group accounts laid before the company in general meeting, shall be annexed to the balance sheet, and the auditors’ report shall be attached thereto.

(4)Any accounts annexed pursuant to subsection (3) shall be approved by the board of directors before the balance sheet is signed on their behalf.

(5) If any copy of a balance sheet which has not been signed as required by this section is issued, circulated or published, or if any copy of a balance sheet is issued circulated or published without having annexed thereto a copy of the profit and loss account or any group accounts required by this section to be so annexed, or without having attached thereto a copy of the auditors’report, the company, and every officer of the company who is in default shall be liable to a fine not exceeding one hundred thousand dollars.

153.—(1) In the case of every company, a copy of every balance sheet, including every document required by law to be annexed thereto which is to be laid before the company in general meeting, together with a copy of the auditors’ report, shall, not less than twenty-one days before the date of the meeting, be sent to every member of the company (whether or not he is entitled to receive notice of general meetings of the company), every holder of debentures of the company (whether or not he is so entitled) and all persons other than members or holders of debentures of the company, being persons so entitled.

(2) In the case of a company not being a private company any member of the company, and any holder of debentures of the company, shall be entitled to be furnished on demand without charge with a copy of the last balance sheet of the company, including every document required by law to be annexed thereto, together with a copy of the auditors’ report on the balance sheet.

Right to receive copies of balance sheets and auditor's report.

[No. ] The Companies Act, 2004116

(3) If default is made in complying with subsection (1), the company and every officer of the company who is in default, shall be liable to a fine not exceeding one hundred thousand dollars, and if, where any person makes a demand for a document with which he is by virtue of subsection (2) entitled to be furnished, default is made in complying with the demand within ten days after the making thereof, the company and every officer of the company who is knowingly a party to the default shall be liable to a fine not exceeding two thousand dollars for every day during which the default continues, unless it is proved that that person has already made a demand for and been furnished with a copy of the document.

(4) In thecaseofaprivatecompany,anymemberof thecompany and any holder of debentures thereof shall be entitled to be furnished, within tendaysafterhehasmadea request in thatbehalf to thecompany, with a copy of the balance sheet and auditors’ report at a charge not exceeding two hundred dollars or such amount as may be prescribed by regulations made by the Minister.

(5) If default is made in furnishing such a copy to any member of the company or, as the case may be, any holder of debentures thereof who demands it and tenders to the company the amount of the proper charge therefor, the company and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

154.—(1) Every company shall at each annual general meeting appoint an auditor or auditors to hold office from the conclusion of that, until the conclusion of the next, annual general meeting.

(2) At any annual general meeting a retiring auditor, however appointed, shall be reappointed without any resolution being passed unless—

(a) he is not qualified for reappointment; or

(b) a resolution has been passed at that meeting appointing somebody insteadofhimorprovidingexpressly thathe shall not be reappointed; or

(c) hehasgiventhecompanynoticeinwritingofhisunwillingness to be reappointed:

Appointment and remuneration of auditors.

117The Companies Act, 2004 [No. ]

Providedthatwherenotice isgivenofanintendedresolutiontoappoint some person or persons in place of a retiring auditor, and by reason of the death, incapacity or disqualification of that person or of all those persons, as the case may be, the resolution cannot be proceeded with, the retiring auditor shall not be automatically reappointed by virtue of this subsection.

(3) Whereatanannualgeneralmeetingnoauditorsareappointed or reappointed, the Minister may appoint a person to fill the vacancy.

(4) The company shall, within seven days of the Minister’s power under subsection (3) becoming exercisable, give him notice of that fact, and if a company fails to give notice as required by this subsection the company and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

(5) Special notice shall be required for a resolution at a company’s annual general meeting appointing as auditor a person other than a retiring auditor or providing expressly that a retiring auditor shall not be reappointed.

(6) On receipt of notice of such an intended resolution as aforesaid, thecompanyshall forthwithsendacopy thereof to the retiring auditor (if any).

(7) Where notice is given of such an intended resolution as aforesaid and the retiring auditor makes with respect to the intended resolution representations in writing to the company (not exceeding a reasonable length) and requests their notification to members of the company, the company shall, unless the representations are received by it too late for it do so—

(a) in any notice of the resolution given to the members of the company, state the fact of the representations having been made; and

(b) send a copy of the representations to every member of the company to whom notice of the meeting is sent (whether before or after receipt of the representations by the company),

[No. ] The Companies Act, 2004118

and if a copy of the representations is not sent as aforesaid because received too late or because of the company’s default, the auditor may (without prejudice to his right to be heard orally) require that the representations shall be read out at the meeting:

Provided that copies of the representations need not be sent out and the representations need not be read out at the meeting if, on the application either of the company or of any other person who claims to be aggrieved, the Court is satisfied that the rights conferred by this section are being abused to secure needless publicity for defamatory matter; and the Court may order the company’s costs on an application under this section to be paid in whole or in part by the auditor, notwithstanding that he is not a party to the application.

(8) Subsection (7) shall apply to a resolution to remove the first auditorsbyvirtueof subsection (9)as it applies in relation toa resolution that a retiring auditor shall not be reappointed.

(9) Subject as hereinafter provided, the first auditors of a company may be appointed by the directors at any time before the first annual general meeting, and the auditors so appointed shall hold office until theconclusionof thatmeeting:

Provided that—

(a) the company may at a general meeting of which notice has been served on the auditors in the same manner as on members of the company remove any such auditors and appoint in their place any other persons being persons who have been nominated for appointment by any member of the company and of whose nomination notice has been given to the members of the company not less than seven days before the date of the meeting; and

(b) if the directors fail to exercise their powers under this subsection, the company in general meeting may appoint the first auditors, and thereupon those powers of the directors shall cease.

119The Companies Act, 2004 [No. ]

(10) The directors may fill any casual vacancy in the office of auditor,butwhileanysuchvacancycontinues thesurvivingorcontinuing auditor or auditors, if any, may act.

(11) The remuneration of the auditors of a company shall be fixed by the company in general meeting or in such manner as the companyingeneralmeetingmaydetermine,except that theremuneration of an auditor appointed before the first annual general meeting, or of an auditor appointed to fill a casual vacancy, may be fixed by the directors, and that the remuneration of an auditor appointed by the Minister may be fixed by the Minister.

(12) For the purposes of this subsection, any sums paid or to be paid by the company in respect of the auditors’ expenses shall be deemed to be included in the expression “remuneration”.

155. Aperson shall not be qualified for appointment as auditor of a companywhich isnotaprivatecompanyorofaprivatecompanywhich is obliged to file accounts unless he is a registered public accountant as defined in section 2 of the PublicAccountancyAct.

156. Noneof thefollowingpersonsshallbequalifiedforappointment as auditor of a company—

(a) an officer or servant of the company;

(b) a person who is a partner of or in the employment of an officer or servant of the company;

(c) a body corporate.

157.—(1) The auditors shall make a report to the members on the accounts examined by them, and on every balance sheet, every profit and loss account and all group accounts laid before the company in generalmeetingduring their tenureofoffice, and the report shall contain statements as to the matters mentioned in the Seventh and Eighth Schedules.

(2) The auditors’ report shall be read before the company in general meeting and shall be open to inspection by any member.

(3) Every auditor of a company shall have a right of access at all times to the books and accounts and vouchers of the company, and

Qualification for appointment as auditor.

Disqualification for appointment as auditor.

Auditor's report and right of access to books and to attend and be heard at general meetings. Seventh and Eighth Schedules.

[No. ] The Companies Act, 2004120

shall be entitled to require from the officers of the company such information and explanation as he thinks necessary for the performance of the duties of the auditors.

(4) The auditors of a company shall be entitled to attend any general meeting of the company and to receive all notices of and other communications relating to any general meeting which any member of thecompany isentitled to receiveand tobeheardat anygeneralmeeting which they attend on any part of the business of the meeting which concerns them as auditors.

(5) If any person makes default in complying with any of the requirements of this section, he shall be liable to a fine not exceeding one hundred thousand dollars.

158.—(1) Subject to this section, a company may, in general meeting, declare dividends in respect of any year or other period.

(2) Where, pursuant to the articles of a company, the recommendation of the directors of a company with respect to the declaration of a dividend is rejected or varied by the company in general meeting, a statement to that effect shall be included in the relevant directors’ annual report.

(3) No dividend shall be payable to the shareholders of a company except out of profits.

(4) Acompany shall not declare or pay a dividend if there are reasonable grounds for believing that—

(a) the company is, or would be after the payment, unable to pay its liabilities as they become due; or

(b) the realizable value of the company’s assets would thereby be less than the aggregate of its liabilities and stated capital.

159.—(1) Acompany,whichmeets thecriteriaspecified inparagraph 7 of Part II of the Seventh Schedule in a given financial year and in respect of which a resolution is passed in accordance with subsection (2) and is not—

(a) a public company;

(b) a private company whose articles provide otherwise;

(c) a company licensed under the BankingAct;

Exemption from the provisions of audited reports.

Dividends.

121The Companies Act, 2004 [No. ]

(d) an insurance company registered under the InsuranceAct;

(e) a company licensed under the SecuritiesAct;

(f) a company licensed under the Financial InstitutionsAct;

(g) a society registered under the Building SocietiesAct or the Cooperative SocietiesAct;

(h) asubsidiaryofacompany, fallingwithinanyof thecategories in paragraphs (a) to (g),

shall be exempt from providing audited financial statements and an auditor's report as required under thisAct with respect to that financial year.

(2) A resolutionreferred to insubsection(1)shallbearesolution passed unanimously at a general meeting of the company in relation to the financial year referred to in that subsection.".

Inspection

160.—(1) The Minister may appoint one or more competent inspectors to investigate the affairs of a company and to report thereon in such manner as he may direct—

(a) in the case of a company having a share capital, on the application either of not less than two hundred members or of members holding not less than one-tenth of the shares issued;

(b) in the case of a company not having a share capital, on the applicationof not less thanone-fifth innumberof thepersons on the company’s register of members.

(2) The application shall be supported by such evidence as the Minister may require for the purpose of showing that the applicants have good reason for requiring the investigation, and the Minister may, before appointing an inspector, require the applicants to give security, to an amount not exceeding two hundred thousand dollars, for payment of the costs of the investigation.

161. Without prejudice to his powers under section 164 the Minister—

Investigation of company's affairs on application of members.

Investigation of company's affairs in other cases.

[No. ] The Companies Act, 2004122

(a) shall appointoneormorecompetent inspectors to investigate theaffairsofacompanyand to report thereon insuchmanner as he may direct, if—

(i) the company by special resolution; or

(ii) the Court by order,

declares that itsaffairsought tobeinvestigatedbyaninspector appointed by the Minister; and

(b) may do so if it appears to the Minister that there are circumstancessuggesting—

(i) that its business is being conducted with intent to defraud its creditors or the creditors of any other person or otherwise for a fraudulent or unlawful purpose or in a manner oppressive of any part of its members or that it was formed for any fraudulent or unlawful purpose; or

(ii) that persons concerned with its formation or the management of its affairs have in connection therewithbeenguiltyoffraud,misfeasanceorother misconduct towards it or towards its members; or

(iii) that its members have not been given all the information with respect to its affairs which they might reasonably expect.

162. If an inspector appointed under either section 160 or section 161 to investigate the affairs of a company thinks it necessary for the purposes of his investigation to investigate also the affairs of any other body corporate which is or has at any relevant time been the company’s subsidiary or holding company or a subsidiary of its holding company or a holding company of its subsidiary, he shall have power so to do, and shall report on the affairs of the other body corporate so far as he thinks the results of his investigation thereof are relevant to the investigation of the affairs of the firstmentioned company.

Power of inspectors to cary investigation into affairs of related companies.

123The Companies Act, 2004 [No. ]

163.—(1) It shallbe thedutyofallofficersandagentsof thecompany and of all officers and agents of any other body corporate whose affairs are investigated by virtue of section 162 to produce to the inspectors all books and documents of or relating to the company or, as the case may be, the other body corporate which are in their custody or power and otherwise to give to the inspectors all assistance in connection with the investigation which they are reasonably able to give.

(2) An inspector may examine on oath the officers and agents of the company or other body corporate in relation to its business, and may administer an oath accordingly.

(3) If any officer or agent of the company or other body corporate refuses to produce to the inspectors any book or document which it is his duty under this section so to produce, or refuses to answer any question which is put to him by the inspectors with respect to the affairs of the company or other body corporate, as the case may be, the inspectors may certify the refusal under their hand to the Court, and the Court may thereupon inquire into the case, and after hearing any witnesses who may be produced against or on behalf of the alleged offender and after hearing any statement which may be offered in defence, punish the offender in like manner as if he had been guilty of contempt of the Court.

(4) If an inspector thinks it necessary for the purpose of his investigation that a person whom he has no power to examine on oath should be so examined, he may apply to the Court and the Court may if it sees fit order that person to attend and be examined on oath before it on any matter relevant to the investigation, and on any such examination—

(a) the inspector may take part therein either personally or by an attorney-at-law;

(b) the Court may put such questions to the person examined as the Court thinks fit;

(c) the person examined shall answer all such questions as the Court may put or allow to be put to him, but may at his own cost employ an attorney-at-law who shall be at liberty to put

Production of documents, and evidence on investigation.

[No. ] The Companies Act, 2004124

to him such questions as the attorney-at-law may deem just for the purpose of enabling him to explain or qualify any answers given by him,

and notes of the examination shall be taken down in writing, and shall be read over to or by, and signed by, the person examined, and may thereafter be used in evidence against him:

Provided that, notwithstanding anything in paragraph (c) of this subsection, the Court may allow the person examined such costs as in its discretion it may think fit, and any costs so allowed shall be paid as part of the expenses of the investigation.

(5) In this section, any reference to officers or to agents shall include past, as well as present, officers or agents, as the case may be, and for the purposes of this section the expression “agents”, in relation to a company or other body corporate shall include the bankers and attorneys of the company or other body corporate and any persons employed by the company or other body corporate as auditors, whether or not those persons are officers of the company or other body corporate.

164.—(1) The inspectors may, and, if so directed by the Minister, shall, make interim reports to the Minister, and on the conclusion of the investigation shall make a final report to the Minister.

(2) Any such report shall be written or printed, as the Minister may direct.

(3) The Minister shall—

(a) forward a copy of any report made by the inspectors to the registered office of the company;

(b) if the Minister thinks fit, furnish a copy thereof on request and on payment of the prescribed fee to any other person who is a member of the company or of any other body corporate dealt with in the report by virtue of section 162 or whose interests as a creditor of the company or of any such other body corporate as aforesaid appear to the Minister to be affected;

Inspectors' report.

125The Companies Act, 2004 [No. ]

(c) where the inspectorsareappointedundersection160, furnish, at the request of the applicants for the investigation, a copy to them; and

(d) where the inspectors are appointed under section 161 in pursuance of an order of the Court, furnish a copy to the Court,

and may also cause the report to be printed and published.

165.—(1) If from any report made under section 164 it appears to the Minister that any person has, in relation to the company or to any other body corporate whose affairs have been investigated by virtue of section 162 been guilty of any offence for which he is criminally liable, the Minister shall, if it appears to him that the case is one in which the prosecution ought to be undertaken by the Director of Public Prosecutions refer the matter to him.

(2) If, where any matter is referred to the Director of Public Prosecutions under this section, he considers that the case is one in whichaprosecutionought tobe instituted,he shall instituteproceedings accordingly, and it shall be the duty of all officers and agents of the company or other body corporate as aforesaid, as the case may be (other than the defendant in the proceedings), to give him all assistance in connection with the prosecution which they are reasonably able to give.

(3) Subsection (5) of section 163 shall apply for the purposes of this subsection as it applies for the purposes of that section.

(4) If, in the case of any body corporate liable to be wound up under this Act, it appears to the Minister from any such report as aforesaid that it is expedient so to do by reason of any such circumstances as are referred to in sub-paragraph (i)or (ii) of paragraph (b)of section161, theMinistermay,unless thebodycorporate isalready being wound up by the Court, present a petition for it to be so wound up if the Court thinks it just and equitable that it should be wound up or a petition for an order under section 213 or both.

(5) If fromanysuchreport asaforesaid it appears to theMinister that proceedings ought in the public interest to be brought by any body

Proceedings on inspector's report.

[No. ] The Companies Act, 2004126

corporate dealt with by the report for the recovery of damages in respect of any fraud, misfeasance or other misconduct in connection with the promotion or formation of that body corporate or the management of its affairs, or for the recovery of any property of the body corporate which has been misapplied or wrongfully retained, the Minister may himself bring proceedings for that purpose in the name of the body corporate.

(6) The Minister shall indemnify the body corporate against any costs or expenses incurred by it or in connection with any proceedings brought by virtue of subsection (5).

166.—(1) The expenses of and incidental to an investigation by an inspector appointed by the Minister under the foregoing provisions of thisAct shall be defrayed in the first instance by the Minister, but the following persons shall, to the extent mentioned, be liable to repay the Minister—

(a) any person who is convicted on a prosecution instituted as a result of the investigation by the Director of Public Prosecutions, or who is ordered to pay damages or restore any property in proceedings brought by virtue of subsection (5) of section 165, may in the same proceedings be ordered to pay the expenses to such extent as may be specified in the order;

(b) any body corporate in whose name proceedings are brought as aforesaid shall be liable to the amount or value of any sums or property recovered by it as a result of those proceedings; and

(c) unlessasaresultof the investigationaprosecutionis instituted by the Director of Public Prosecutions—

(i) anybodycorporatedealtwithby thereport,where the inspector was appointed otherwise than of the Minister’s own motion, shall be liable, except so far as the Minister otherwise directs; and

(ii) the applicants for the investigation, where the inspector was appointed under section 162, shall

Expenses of investigation of company's affairs.

127The Companies Act, 2004 [No. ]

be liable to such extent (if any) as the Minister may direct, and any amount for which a body corporate is liable by virtue of paragraph (b) of this subsection shall be a first charge on the sums or property mentioned in that paragraph.

(2) The report of an inspector appointed otherwise than of the Minister’s own motion may, if the inspector thinks fit, and shall, if the Minister so directs, include a recommendation as to the directions (if any) which the inspector thinks appropriate, in the light of his investigation, to be given under paragraph (c) of subsection (1).

(3) For the purposes of this section, any costs or expenses incurred by the Minister in or in connection with proceedings brought by virtue of subsection (5) of section 165 (including expenses incurred by virtue of subsection (6) thereof) shall be treated as expenses of the investigation giving rise to the proceedings.

(4) Any liability to repay the Minister imposed by paragraphs (a)and(b)ofsubsection(1)shall, subject tosatisfactionof theMinister’s right to repayment, be a liability also to indemnify all persons against liability under paragraph (c) thereof, and any such liability imposed by paragraph (a) shall, subject as aforesaid, be a liability also to indemnify all persons against liability under paragraph (b); and any person liable under paragraph (a) or (b) or either sub-paragraph of paragraph (c) shall be entitled to contribution from any other person liable under the same paragraph or subparagraph, as the case may be, according to the amount of their respective liabilities thereunder.

(5) The expenses incurred by the Minister under this section shall, so farasnot recovered thereunder,bepaidoutofmoneysprovided by Parliament.

167. A copy of any report of any inspectors appointed under the foregoingprovisionsof thisAct,authenticatedbythesealof thecompany whose affairs they have investigated, shall be admissible in any legal proceeding as evidence of the opinion of the inspectors in relation to any matter contained in the report.

Inspectors' report to be evidence.

[No. ] The Companies Act, 2004128

168.—(1) Where it appears to the Minister that there is good reason so to do, he may appoint one or more competent inspectors to investigateandreporton themembershipofanycompanyandotherwise with respect to the company for the purpose of determining the true persons who are or have been financially interested in the success or failure (real or apparent) of the company or able to control or materially to influence the policy of the company.

(2) The appointment of an inspector under this section may define the scope of his investigation, whether as respects the matters or the period to which it is to extend or otherwise, and in particular may limit the investigation to matters connected with particular shares or debentures.

(3) Where an application for an investigation under this section with respect to particular shares or debentures of a company is made to the Minister by members of the company, and the number of applicants or the amount of the shares held by them is not less than that required for an application for the appointment of an inspector under section 160, the Minister shall appoint an inspector to conduct the investigation unless he is satisfied that the application is vexatious, and the inspector’s appoinment shall not exclude from the scope of his investigation any matter which the application seeks to have included therein, except in so far as the Minister is satisfied that it is unreasonable for that matter to be investigated.

(4) Subject to the termsofan inspector’sappointmenthispowers shall extend to the investigation of any circumstances suggesting the existenceofanarrangementorunderstandingwhich, thoughnot legally binding, is or was observed or likely to be observed in practice and which is relevant to the purposes of his investigation.

(5) For the purposes of any investigation under this section, sections 162 to 164 shall apply with the necessary modifications of references to the affairs of the company or to those of any other body corporate, so, however, that—

(a) those sections shall apply in relation to all persons who are or have been, or whom the inspector has reasonable cause

Appointment and powers of inspectors t o investigate ownership of company.

129The Companies Act, 2004 [No. ]

to believe to be or have been, financially interested in the success or failure or the apparent success or failure of the company or any other body corporate whose membership is investigated with that of the company, or able to control ormaterially to influencethepolicythereof, includingpersons concerned only on behalf of others, as they apply in relation to officers and agents of the company or of the other body corporate, as the case may be; and

(b) the Minister shall not be bound to furnish the company or any other person with a copy of any report by an inspector appointed under this section or with a complete copy thereof if he is of opinion that there is good reason for not divulging the contents of the report or of parts thereof, but shall cause to be kept by the Registrar a copy of any such report or, as the case may be, the parts of any such report, as respects which he is not of that opinion.

(6) The expenses of any investigation under this section shall be paid out of moneys provided by Parliament.

169.—(1) Where it appears to the Minister that there is good reason to investigate theownershipofanyshares inordebenturesofacompany and that it is unnecessary to appoint an inspector for the purpose, he may require any person whom he has reasonable cause to believe—

(a) to be or to have been interested in those shares or debentures; or

(b) to act or have acted in relation to those shares or debentures as the attorney or agent of someone interested therein,

to give to the Minister any information which such person has or can reasonably be expected to obtain as to the present and past interests in those shares or debentures and the names and addresses of the persons interested and of any persons who act or have acted on their behalf in relation to the shares or debentures.

(2) For the purposes of this section, a person shall be deemed to have an interest in a share or debenture if he has any right to acquire

Power to require information as to persons interested in shares of debentures.

[No. ] The Companies Act, 2004130

or dispose of the share or debenture or any interest therein or to vote in respect thereof, or if his consent is necessary for the exercise of any of therightsofotherpersons interested therein,or ifotherpersons interested therein can be required or are accustomed to exercise their rights in accordance with his instructions.

(3) Any person who fails to give any information required of himunder this section,orwhoingivinganysuch informationmakesany statementwhichheknowstobefalse inamaterialparticular,or recklessly makes any statement which is false in a material particular, shall be liable on summary conviction before a Resident Magistrate to imprisonment with or without hard labour for a term not exceeding six months or to a fine not exceeding fifty thousand dollars or to both such imprisonmentandfine.

170.—(1) Where in connection with an investigation under either section 168 or 169 it appears to the Minister that there is difficulty in finding out the relevant facts about any shares (whether issued or to be issued),andthat thedifficultyisduewhollyormainlytotheunwillingness of the persons concerned or any of them to assist the investigation as required by thisAct, the Minister may by order direct that the shares shall until further order be subject to the restrictions imposed by this section.

(2) So long as any shares are directed to be subject to the restrictions imposed by this section—

(a) any transfer of those shares, or in the case of unissued shares any transfer of the right to be issued therewith and any issue thereof, shall be void;

(b) no voting rights shall be exercisable in respect of those shares;

(c) no further shares shall be issued in right of those shares or in pursuance of any offer made to the holder thereof;

(d) except ina liquidationnopayment shallbemadeofanysums due from the company on those shares, whether in respect of capital or otherwise.

Power to impose restrictions on shares or debentures.

131The Companies Act, 2004 [No. ]

(3) Where the Minister makes an order directing that shares shall be subject to the said restrictions, or refuses to make an order directing that shares shall cease to be subject thereto, any person aggrieved thereby may apply to the Court, and the Court may, if it sees fit, direct that the shares shall cease to be subject to those restrictions.

(4) Any order (whether of the Minister or of the Court) directing that shares shall cease to be subject to restrictions which is expressed to be made with a view to permitting a transfer of those shares may continue the restrictions mentioned in paragraphs (c) and (d) of subsection (2), either in whole or in part, so far as they relate to any right acquired or offer made before the transfer.

(5) Any person who—

(a) exercises or purports to exercise any right to dispose of any shareswhich, tohisknowledge,are for the timebeingsubject to those restrictions or of any right to be issued with any such shares; or

(b) votes in respect of any such shares, whether as holder or proxy, or appoints a proxy to vote in respect thereof; or

(c) being the holder of any such shares, fails to notify of their being subject to those restrictions any person whom he does not know to be aware of that fact but knows to be entitled, apart from the restrictions, to vote in respect of those shares whether as holder or proxy,

shall be liable on summary conviction before a Resident Magistrate to imprisonment with or without hard labour for a term not exceeding six months or to a fine not exceeding fifty thousand dollars or to both such imprisonmentandfine.

(6) Where shares in any company are issued in contravention of the restrictions, the company and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

(7) Aprosecution shall not be instituted under this section by any person other than the Director of Public Prosecutions except by or with the consent of the Minister.

[No. ] The Companies Act, 2004132

(8) This section shall apply in relation to debentures as it applies in relation to shares.

171. Nothing in the foregoing provisions of this Part shall require disclosure to the Minister or to any inspector appointed by him—

(a) byanattorneyofanyprivilegedcommunicationmadetohim in that capacity, except as respects the name and address of his client; or

(b) by a company’s bankers as such of any information as to the affairs of any of their customers other than the company.

Directors and other Officers

172.—(1) Aprivate company shall have at least one director, but a public company shall have at least three directors, at least two of whom are not employees of the company or any of its affiliates.

(2) Every company shall have a secretary.

(3) A sole director of a company shall not also be secretary thereof and no company shall—

(a) have as secretary to the company, a corporation the sole director of which is a sole director of the company; or

(b) have as sole director of the company, a corporation the sole director of which is secretary to the company.

(4) It is the duty of the directors of a public company to take all reasonable steps to ensure that the secretary or each joint secretary of the company is a person who appears to them to have the requisite knowledge and experience to discharge the functions of secretary of the company.

(5) Anything required or authorized to be done by or to the secretary of a company may, if the office is vacant or there is for any other reason no secretary capable of acting, be done by or to any assistant or deputy secretary, or, if there is no assistant or deputy secretary capable of acting, by or to any officer of the company authorized generally or specially in that behalf by the directors.

Saving for attorneys and bankers.

Number of directors and secretary.

133The Companies Act, 2004 [No. ]

(6) Notice of the appointment of a secretary to a company shall be given to the Registrar in the prescribed form within fifteen days after the date of that appointment.

173. A provision requiring or authorizing a thing to be done by or to a director and the secretary shall not be satisfied by its being done by or to the same person acting both as director and as, or in place of, the secretary.

174.—(1) Every director and officer of a company in exercising his powers and discharging his duties shall—

(a) act honestly and in good faith with a view to the best interest of the company; and

(b) exercise thecare,diligenceandskill thata reasonablyprudent person would exercise in comparable circumstances, including, but not limited to the general knowledge, skill and experience of the director or officer.

(2) A director or officer of a company shall not be in breach of his duty under this section if the director or officer exercised due care, diligence and skill in the performance of that duty or believed in the existence of facts that, if true, would render the director’s or officer’s conduct reasonably prudent.

(3) For the purposes of this section, a director or officer shall be deemed to have acted with due care, diligence and skill where, in the absence of fraud or bad faith, the director or officer reasonably relied in good faith on documents relating to the company’s affairs, including financial statements, reports of experts or on information presented by other directors or, where appropriate, other officers and professionals.

(4) In determining what are the best interests of the company, a director or officer may have regard to the interests of the company’s shareholders and employees and the community in which the company operates.

(5) The duties imposed by subsection (1) on the directors or officers of a company is owed to the company alone.

Avoidance of acts done by persons in dual capacity as director and secretary.

Duty of care.

[No. ] The Companies Act, 2004134

(6) Where pursuant to a contract of service with a company, a director or officer is required to perform management functions, the terms of that contract may require the director or officer in the exercise of those functions, to observe a higher standard than that specified in subsection (1).

175.—(1) Aperson shall not be capable of being appointed director of a company by the articles, and shall not be named as a director or proposed director of a company in a prospectus issued by or on behalf of the company, or as proposed director of an intended company in a prospectus issued in relation to that intended company, or in a statement in lieu of prospectus delivered to the Registrar by or on behalf of a company,unless,before the registrationof thearticlesor thepublication of the prospectus, or the delivery of the statement in lieu of prospectus, as the case may be, he has by himself or by his agent authorized in writing—

(a) signedanddelivered to theRegistrar for registrationaconsent in writing to act as such director; and

(b) either—

(i) signed the articles for a number of shares not less than his qualification, if any; or

(ii) taken from the company and paid or agreed to pay for his qualification shares, if any; or

(iii) signed and delivered to the Registrar for registrationanundertaking inwriting to take from the company and pay for his qualification shares, if any; or

(iv) madeanddeliveredto theRegistrar for registration a statutory declaration to the effect that a number of shares, not less thanhisqualification, if any, are registered in his name.

(2) Where a person has signed and delivered as aforesaid an undertaking to take and pay for his qualification shares, he shall, as regards those shares, be in the same position as if he had signed the articles for that number of shares.

Restrictions on appointment or advertisement of director.

135The Companies Act, 2004 [No. ]

(3) On the application for registration of the articles of a company the applicant shall deliver to the Registrar a list of the persons who have consented to be directors of the company, and if this list contains thenameofanypersonwhohasnot soconsented, theapplicant shall be liable to a fine not exceeding one hundred thousand dollars.

(4) This section shall not apply to—

(a) a company not having a share capital; or

(b) a private company; or

(c) a company which was a private company before becoming a public company; or

(d) a prospectus issued by or on behalf of a company after the expiration of one year from the date on which the company was entitled to commence business.

176. The acts of a director or manager shall be valid notwithstanding any defect that may afterwards be discovered in his appointment or qualification.

177.—(1) Without prejudice to the restrictions imposed by section 175, it shall be the duty of every director who is by the articles of the company required to hold a specified share qualification, and who is not already qualified, to obtain his qualification within two months after his appointment, or such shorter time as may be fixed by the articles.

(2) For the purpose of any provision in the articles requiring a directororotherofficer toholdaspecifiedsharequalification, thebearer of a share warrant shall not be deemed to be the holder of the share specified in the warrant.

(3) The office of director of a company shall be vacated if the director does not within two months from the date of his appointment, or within such shorter time as may be fixed by the articles, obtain his qualification, or if after the expiration of that period or shorter time he ceases at any time to hold his qualification.

(4) Apersonvacatingofficeunder this sectionshallbe incapable of being reappointed director of the company until he has obtained his qualification.

Validity of acts of directors.

Share qualifications of directors.

[No. ] The Companies Act, 2004136

(5) If after the expiration of the period or shorter time any unqualified person acts as a director of the company, he shall be liable to a fine not exceeding two thousand dollars for every day between the expiration of the period or shorter time or the day on which he ceased to be qualified, as the case may be, and the last day on which it is proved that he acted as a director.

178.—(1) At a general meeting of a company other than a private company, a motion for the appointment of two or more persons as directorsof thecompanybyasingle resolutionshallnotbemade,unless a resolution that it shall be so made has first been agreed to by the meeting without any vote being given against it.

(2) Aresolution moved in contravention of this section shall be void, whether or not its being so moved was objected to at the time:

Provided that—

(a) this subsection shall not be taken as excluding the operation of section 176; and

(b) where a resolution so moved is passed, no provision for the automatic reappointment of retiring directors in default of another appointment shall apply.

(3) For the purposes of this section, a motion for approving a person’s appointment or for nominating a person for appointment shall be treated as a motion for his appointment.

(4) Nothing in this section shall apply to a resolution altering the company’s articles.

179.—(1) Acompany may by ordinary resolution remove a director before the expiration of his period of officenotwithstanding anything in its articles or in any agreement between it and him:

Provided that this subsection shall not, in the case of a private company, authorize the removal of a director holding office for life on the 5th of February, 1963, whether or not subject to retirement under an age limit by virtue of the articles or otherwise.

Appointment of directors to be voted on individually.

Removal of directors.

137The Companies Act, 2004 [No. ]

(2) Special notice shall be required of any resolution to remove adirectorunder this sectionor toappoint somebody insteadofadirector so removed at the meeting at which he is removed, and on receipt of notice of an intended resolution to remove a director under this section the company shall forthwith send a copy thereof to the director concerned, and the director (whether or not he is a member of the company) shall be entitled to be heard on the resolution at the meeting.

(3) Where notice is given of an intended resolution to remove a directorunder this sectionand thedirectorconcernedmakeswith respect thereto representations in writing to the company (not exceeding a reasonable length) and requests their notification to members of the company, the company shall, unless the representations are received by it too late for it to do so—

(a) in any notice of the resolution given to members of the company state the fact of the representations having been made; and

(b) send a copy of the representations to every member of the company to whom notice of the meeting is sent (whether beforeorafter receiptof the representationsby thecompany),

and if a copy of the representations is not sent as aforesaid because received too late or because of the company’s default, the director may (without prejudice to his right to be heard orally) require that the representations shall be read out at the meeting:

Provided that copies of the representations need not be sent out and the representations need not be read out at the meeting if, on the application either of the company or of any other person who claims to be aggrieved, the Court is satisfied that the rights conferred by this section are being abused to secure needless publicity for defamatory matter; and the Court may order the company’s costs on an application under this section to be paid in whole or in part by the director, notwithstanding that he is not a party to the application.

(4) Avacancy created by the removal of a director under this section, if not filled at the meeting at which he is removed, may be filled as a casual vacancy.

[No. ] The Companies Act, 2004138

(5) Aperson appointed director in place of a person removed under this section shall be treated, for the purpose of determining the time at which he or any other director is to retire, as if he had become director on the day on which the person in whose place he is appointed was last appointed a director.

(6) Nothing in this section shall be taken as depriving a person removed thereunder of compensation or damages payable to him in respect of the termination of his appointment as director or of any appointment terminating with that as director or as derogating from any power to remove a director which may exist apart from this section.

180.—(1) Where, pursuant to subsection (2), a complaint is made to the Registrar by—

(a) shareholders of a company;

(b) members of the board of directors of a company or creditors of a company, as the case may be; or

(c) the liquidator of the company, or the Trustee,

that person is unfit to be concerned in the management of a company, the Registrar shall act in accordance with subsection (3).

(2) Acomplaint referred to in subsection (1) shall be in writing and shall state the grounds on which it is made.

(3) Upon receipt of such a complaint the Registrar shall—

(a) investigate the matter and afford to the complainants an opportunity to be heard; and

(b) if satisfied that there are sufficient grounds for a hearing of the matter by the Court, issue a certificate to that effect to the shareholders, liquidator, Trustee, members or creditors, as the case may be, who shall, subject to subsection (7), have the right to make an application to the Court on the matter.

(4) Any shareholder, member or creditor, as the case may be, who is aggrieved by a refusal of the Registrar to issue a certificate referred to in subsection (3) (b), may appeal against that decision to the Master in Chambers.

Court disqualified directors.

139The Companies Act, 2004 [No. ]

(5) Where the Registrar is satisfied that a person is unfit to be concerned in the management of a company, the Registrar may make an application to the Court on the matter.

(6) Where, on an application made pursuant to subsection (3) (b) or (5), it is made to appear to the Court that a person is unfit to be concerned in the management of a company, the Court may order that, without the prior leave of the Court, that person may not be a director of the company, or in any way, directly or indirectly, be concerned with the management of the company for such period as may be specified in the order—

(a) beginningwith thedateof theorderor, if thepersonisserving, or is to serve, a term of imprisonment and the Court so directs, beginning with the date on which he completes that term of imprisonment or is otherwise released from prison; and

(b) not exceeding five years.

(7) In determining whether or not to make an order under subsection (6) the Court shall have regard to the following—

(a) any misfeasance or breach of any fiduciary or other duty by the director in relation to the company;

(b) any misapplications or retention by the director of, or any conductby thedirectorgiving rise toanobligation toaccount for, any money or other property of the company;

(c) the extent of the director's responsibility for any failure by the company to comply with the provisions of thisAct in relation to the keeping and maintenance of accounting records;

(d) whether the director has knowingly been party to carrying on the business of the company in a manner for which he may be liable (whether he has been convicted or not) under section 322;

(e) such other circumstances as may be prescribed.

[No. ] The Companies Act, 2004140

(8) Before making an application under this section in relation to any person, the Registrar or any other person intending to apply shall give to the person concerned not less than ten days’ notice of the intention to make the application.

(9) On the hearing of an application made under this section or, as the case may be, an application for leave as mentioned in subsection (6), any person concerned with the application may appear and call attention to any matters that are relevant, and may give evidence, call witnesses and be represented by an attorney-at-law.

181.—(1) If any person being an undischarged bankrupt acts as director of, or directly or indirectly takes part in, or is concerned in the management of, any company except with the leave of the Court, he shallbeliableonconvictiononindictmenttoimprisonmentwithorwithout hard labour for a term not exceeding two years, or on summary convictionbeforeaResidentMagistrate to imprisonmentwithorwithout hard labour fora termnotexceeding twoyearsor toa finenot exceeding two hundred thousand dollars, or to both such imprisonment and fine:

Provided that a person shall not be guilty of an offence under this section by reason that he, being an undischarged bankrupt, has acted as director of, or taken part or been concerned in the management of a company, if he was on the appointed day acting as director of, or taking part or being concerned in the management of, that company and has continuously so acted, taken part, or been concerned since that date and the bankruptcy was prior to that date.

(2) Leave of the Court for the purposes of this section shall not be given unless notice of intention to apply therefor has been served on theTrustee, and it shall be the duty of theTrustee, if he is of opinion that it is contrary to the public interest that any such application should be granted, to attend on the hearing of and oppose the granting of the application.

(3) In this section the expression “company” includes an unregistered company and a company incorporated outside the Island which has an established place of business within the Island.

Provisions as t o undischarged bankrupts acting as directors.

141The Companies Act, 2004 [No. ]

182.—(1) The Court may make a disqualification order against a person where it appears to the Court that he has been persistently in default in relation to provisions of thisAct requiring any return, account or other document to be filed with, delivered or sent, or notice of any matter to be given, to the Registrar.

(2) On an application to the Court for an order to be made under this section, the fact that a person has been persistently in default in relation to such provisions as are mentioned in subsection (1) may be conclusively proved by showing that in the five years ending with the date of the application he has been adjudged guilty (whether or not on the same occasion) of three or more defaults in relation to those provisions.

(3)Aperson is to be treated under subsection (2) as being adjudged guilty of a default in relation to any provision as aforesaid if—

(a) he is convicted (whether on indictment or summarily) of an offence consisting in a contravention of or failure on his part to comply with that provision; or

(b) a default order is made against him under any provision of thisAct requiring the submission of returns, notices or other documents to the Registrar, in respect of any such contravention of or failure on his part to comply with that provision.

(4) In thissection“Court”meansanycourthavingjurisdiction to wind up any of the companies in relation to which the offence or other default has been or is alleged to have been committed.

(5)Adisqualification order may be made under this section for a period not exceeding five years.

183.—(1) Every company shall keep at its registered office a register of its directors or managers and secretary containing with respect to each of them the following particulars, that is to say—

(a) in the case of an individual, his present Christian name and surname, any former Christian name or surname, his usual residential address, his nationality, and, if that nationality is

Disqualifi- cation for persistent breaches of Act.

Register of directors.

[No. ] The Companies Act, 2004142

not the nationality of origin, his nationality of origin, and his business occupation, if any, or, if he has no business occupation but holds any other directorship or directorships, particulars of that directorship or of some one of those directorships; and

(b) in thecaseofacorporation, its corporatenameandregistered or principal office.

(2) The company shall, within the periods respectively mentioned in this subsection, send to the Registrar a return in the prescribed form containing the particulars specified in the register and a notification in the prescribed form of any change among its directors or in any of the particulars contained in the register specifying the date of the change.

(3) The return shall be sent within fourteen days from the appointment of the first directors of the company, and the notification ofachangeshallbesentwithinfourteendaysfromthehappeningthereof.

(4) The register to be kept under this section shall during business hours (subject to such reasonable restrictions as the company may by its articles or in general meeting impose, so that not less than two hours in each day be allowed for inspection) be open to the inspection of any member of the company without charge and of any otherpersononpaymentof fiftydollars,orsuch lesssumas thecompany may specify, for each inspection.

(5) If any inspection required under this section is refused or if default is made in complying with subsection (1) or subsection (2), the company and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

(6) In the case of any such refusal, the Court may by order compel an immediate inspection of the register.

(7) For the purposes of this section, a shadow director shall be deemed to be a director and officer of the company.

184.—(1) Where circumstances prejudicial to the company exist, thecompanyoranycompanywithwhich it isaffiliatedshallnot,directly

Illicit loans by company.

143The Companies Act, 2004 [No. ]

or indirectly, give financial assistance by means of a loan, guarantee or otherwise—

(a) to a shareholder, director, officer or employee of the company or affiliated company, or to an associate of any such person for any purpose; or

(b) to any person for the purpose of, or in connection with, a purchase of a share issued or to be issued by the company or a company with which it is affiliated.

(2) Circumstancesprejudicial to thecompanyexist in respect of financial assistance mentioned in subsection (1) where there are reasonable grounds for believing that—

(a) the company is unable or would, after giving the financial assistance, be unable to pay its liabilities as they become due; or

(b) the realizable value of the company’s assets, excluding the amount of any financial assistance in the form of a loan and in the form of assets pledged or encumbered to secure a guarantee,would,aftergiving the financialassistance,be less than the aggregate of the company’s liabilities and stated capital of all classes.

(3) For the avoidance of doubt, a contract made by a company or by a person giving financial assistance in contravention of this section shall not, by reason only of that contravention, be rendered void, or unenforceable by the company or person giving financial assistance.

(4) An officer of a company who acts in contravention of this section shall, on summary conviction before a Resident Magistrate be liable to a fine not exceeding one million dollars or to imprisonment fora termnotexceedingtwoyears,or tobothsuchfineandimprisonment and the Resident Magistrate may order that officer to restore to the company, an amount equal to the value of the financial assistance given in contravention of this section.

[No. ] The Companies Act, 2004144

185. Subject to the provisions of thisAct and the company's articles, a company may give financial assistance to any person by means of a loan, guarantee or otherwise—

(a) in the ordinary course of business, if the lending of money is part of the ordinary business of the company;

(b) onaccountofexpenditure incurredor tobe incurredonbehalf of the company;

(c) to a holding body corporate if the company is a wholly owned subsidiary of the holding body corporate;

(d) to any of the company’s subsidiaries;

(e) to employees of the company to enable them to purchase shares in an employee share ownership plan approved under the Employee Share Ownership PlanAct.

186.—(1) It shall not be lawful for a company to make to any director of the company any payment by way of compensation for loss of office, or as consideration for or to in connection with his retirement from office, without particulars with respect to the proposed payment (including the amount thereof) being disclosed to members of the company and the proposal being approved by the company.

(2) If any payment is made to a director of a company in contravention of this section the company and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

187.—(1) It is hereby declared that it is not lawful in connection with the transfer of the whole or any part of the undertaking or property of a company for any payment to be made to any director of the company by way of compensation for loss of office, or as consideration for or in connection with his retirement from office, unless particulars with respect to the proposed payment (including the amount thereof) have been disclosed to the members of the company and the proposal approved by the company.

(2) Where a payment which is hereby declared to be illegal is made to a director of the company, the amount received shall be

Permitted loans.

Approval of company requisite for payment in connection with transfer of property to director for loss of office, etc.

Approval of company required for any payment re transfer of its property to director for loss of office, etc.

145The Companies Act, 2004 [No. ]

deemed to have been received by him in trust for the company, so, however, that in any proceeding instituted by virtue of this subsection for the recovery of any payment, the Court shall have power when justice so requires to order that any sum found to be payable by a director shall be restored in whole or in part to members or former members of the company instead of to the company itself and in that event may order that the necessary inquiries shall be made to ascertain the identity of the members and former members and may give such consequential directions as may be necessary or expedient.

188.—(1) Where, in connection with the transfer to any persons of all or any of the shares in a company, being a transfer resulting from—

(a) an offer made to the general body of shareholders;

(b) an offer made by or on behalf of some other body corporate with a view to the company becoming its subsidiary or a subsidiary of its holding company;

(c) an offer made by or on behalf of an individual with a view to his obtaining the right to exercise or control the exercise of not less than one-third of the voting power at any general meeting of the company; or

(d) any other offer which is conditional on acceptance to a given extent,

a payment is to be made to a director of the company by way of compensation for loss of office, or as consideration for or in connection with his retirement from office, it shall be the duty of that director to take all reasonable steps to secure that particulars with respect to the proposed payment (including the amount thereof) shall be included in or sent with any notice of the offer made for their shares which is given to any shareholders.

(2) If—

(a) any such director fails to take reasonable steps as aforesaid; or

Duty of director to disclose payment for loss of office, etc. made in connection with transfer of shares in company.

[No. ] The Companies Act, 2004146

(b) any person who has been properly required by any such director to include the said particulars in or send them with any such notice as aforesaid fails so to do,

he shall be liable to a fine not exceeding fifty thousand dollars.

(3) If—

(a) the requirements of subsection (1) are not complied with in relation to any such payment as is therein mentioned; or

(b) themakingof theproposedpayment isnot,before the transfer ofanyshares inpursuanceof theoffer, approvedbyameeting summoned for the purpose of the holders of the shares to which the offer relates and of other holders of shares of the same class as any of those shares,

any sum received by the director on account of the payment shall be deemed to have been received by him in trust for any persons who have sold their shares as a result of the offer made, and the expenses incurred by him in distributing that sum amongst those persons shall be borne by him and not retained out of that sum.

(4) Where the shareholders referred to in paragraph (b) of subsection (3) are not all the members of the company and no provision is made by the articles for summoning or regulating such a meeting as is mentioned in that paragraph, the provisions of this Act and of the company’s articles relating to general meetings of the company shall, for that purpose, apply to the meeting either without modification or with suchmodificationsas theMinisteron theapplicationofanyperson concerned may direct for the purpose of adapting them to the circumstances of the meeting.

(5) If at a meeting summoned for the purpose of approving any payment as required by paragraph (b) of subsection (3) a quorum is not present and, after the meeting has been adjourned to a later date, a quorum is again not present, the payment shall be deemed for the purposes of that subsection to have been approved.

147The Companies Act, 2004 [No. ]

189.—(1) Where in proceedings for the recovery of any payment as having, by virtue of subsections (1) and (2) of section 186 or subsections (1) and (3) of section 187, been received by any person in trust, it is shown that—

(a) the payment was made in pursuance of any arrangement entered into as part of the agreement for the transfer in question, or within one year before or two years after that agreement or the offer leading thereto; and

(b) the company or any person to whom the transfer was made was privy to that arrangement,

the payment shall be deemed, except in so far as the contrary is shown, to be one to which the subsections apply.

(2) If in connection with any such transfer as is mentioned in either section 187 or 188—

(a) the price to be paid to a director of the company whose office is to be abolished or who is to retire from office for any shares in the company held by him is in excess of the price which could at the time have been obtained by other holders of the like shares; or

(b) any valuable consideration is given to any such director,

the excess or the money value of the consideration, as the case may be, shall, for thepurposesof that section,bedeemed tohavebeenapayment madetohimbywayofcompensationfor lossofofficeorasconsideration for or in connection with his retirement from office.

(3) It is hereby declared that references in sections 186, 187 and 188 to payments made to any director of a company by way of compensation for loss of office, or as consideration for or in connection with his retirement from office, do not include any bona fide payment by way of damages for breach of contract or by way of pension in respect of past services, and for the purposes of this subsection the expression “pension” includes any superannuation allowance, superannuation gratuity or similar payment.

Provisions supplemen- tary to sections 186, 187 and 188.

[No. ] The Companies Act, 2004148

(4) Nothing in section 186 or 187 shall be taken to prejudice the operation of any rule of law requiring disclosure to be made with respect to any such payments as are therein mentioned or with respect to any other like payments made or to be made to the directors of a company.

190.—(1) In any accounts of a company laid before it in general meeting, or in a statement annexed thereto, there shall, subject to and in accordance with the provisions of this section, be shown so far as the information is in the company’s books and papers or the company has the right-to obtain it from the persons concerned—

(a) the aggregate amount of the directors’ emoluments;

(b) theaggregateamountofdirectors’orpastdirectors’pensions; and

(c) the aggregate amount of any compensation to directors or past directors in respect of loss of office.

(2) The amount to be shown under paragraph (a) of subsection (1)—

(a) shall include any emoluments paid to or receivable by any person in respect of his services as director of the company or in respect of his services, while director of the company, as director of any subsidiary thereof or otherwise in connectionwiththemanagementof theaffairsof thecompany or any subsidiary thereof; and

(b) shall distinguish between emoluments in respect of services as director whether of the company or its subsidiary, and otheremoluments.

(3) The amount to be shown under paragraph (b) of subsection (1)—

(a) shall not include any pension paid or receivable under a pension scheme if the scheme is such that the contributions thereunder are substantially adequate for the maintenance of the scheme, but save as aforesaid shall include any pension

Particulars in accounts of directors' salaries, pensions, etc.

149The Companies Act, 2004 [No. ]

paidor receivable in respectofanysuchservicesofadirector or past director of the company as are mentioned in subsection (2), whether to or by him or, on his nomination or by virtue of dependence on or other connection with him, to or by any other person; and

(b) shall distinguish between pensions in respect of services as director, whether of the company or its subsidiary, and other pensions.

(4) The amount to be shown under paragraph (c) of subsection (1)—

(a) shall include any sums paid to or receivable by a director or past director by way of compensation for the loss of office as director of the company or for the loss, while director of the company or on or in connection with his ceasing to be a director of the company, of any other office in connection with themanagementof thecompany’saffairsorofanyoffice as director or otherwise in connection with the management of the affairs of any subsidiary thereof; and

(b) shalldistinguishbetweencompensationinrespectof theoffice of director, whether of the company or its subsidiary, and compensation in respectofotheroffices,andfor thepurposes of this section references to compensation for loss of office shall include sums paid as consideration for or in connection with a person’s retirement from office.

(5) The amounts to be shown under each paragraph of subsection (1)—

(a) shall include all relevant sums paid by or receivable from—

(i) the company; and

(ii) the company’s subsidiaries; and

(iii) any other person,

except sums to be accounted for to the company or any of its subsidiaries or, by virtue of section 188, to past or present

[No. ] The Companies Act, 2004150

members of the company or any of its subsidiaries or any class of those members; and

(b) shalldistinguish, in thecaseof theamount tobeshownunder paragraph (c) of subsection (1), between the sums respectively paid by or receivable from the company, the company’s subsidiaries and persons other than the company and its subsidiaries.

(6) The amounts to be shown under this section for any financial year shall be the sums receivable in respect of that year, whenever paid, or, in the case of sums not receivable in respect of a period, the sums paid during that year, so, however, that where—

(a) any sums are not shown in the accounts for the relevant financialyearon theground that theperson receiving themis liable to account therefor as mentioned in paragraph (a) of subsection (5), but the liability is thereafter wholly or partly released or is not enforced within a period of two years; or

(b) any sums paid by way of expenses allowance are charged to income tax after the end of the relevant financial year,

those sums shall, to the extent to which the liability is released or not enforced or they are charged as aforesaid, as the case may be, be shown in the first accounts in which it is practicable to show them or. in astatementannexed theretoandshallbedistinguishedfromtheamounts to be shown therein apart from this provision.

(7) Where it is necessary so to do for the purpose of making any distinction required by this section in any amount to be shown thereunder, the directors may apportion any payments between the matters in respect of which they have been paid or are receivable in such manner as they think appropriate.

(8) If in the case of any accounts the requirements of this section are not complied with, it shall be the duty of the auditors of the company by whom the accounts are examined to include in their report thereon, so far as they are reasonably able to do so, a statement giving the required particulars.

151The Companies Act, 2004 [No. ]

(9) In this section—

(a) “contribution”, in relation to a pension scheme, means any payment (including an insurance premium) paid for the purposes of the scheme by or in respect of persons rendering services in respect of which pensions will or may become payable under the scheme, except that it does not include any payment in respect of two or more persons if the amount paid in respect of each of them is not ascertainable;

(b) “emoluments”, in relation to a director, means the gross sum subject to income tax payable to him as emoluments and includes fees and percentages, any sums paid by way of expenses allowance insofar as those sums are charged to income tax, any contribution paid in respect of him under any pension scheme and the estimated money value of any other benefits received by him otherwise than in cash;

(c) “income tax” means the tax payable by individuals and companiesunder the lawfor the timebeingrelating to income tax;

(d) “pension” includes any superannuation allowance, superannuation gratuity or similar payment;

(e) “pension scheme” means a scheme for the provision of pensions in respect of services as director or otherwise is maintained in whole or in part by means of contributions;

(f) any reference to a company’s subsidiary—

(i) in relation to a person who is or was, while a director of the company, a director also, by virtue of the company’s nomination, direct or indirect, of any other body corporate, shall, subject to sub- paragraph (ii), include that body corporate, whether or not it is or was in fact the company’s subsidiary; and

(ii) shall for the purposes of subsections (2) and (3) be taken as referring to a subsidiary at the time

[No. ] The Companies Act, 2004152

the services were rendered, and for the purposes of subsection (4) be taken as referring to a subsidiary immediately before the loss of office as director of the company;

191.—(1) The accounts which, in pursuance of thisAct, are to be laid before every company in general meeting shall, subject to the provisions of this section, contain particulars showing—

(a) theamountofany loansmadeduring thecompany’s financial year to—

(i) any officer of the company;

(ii) any person who, after the making of the loan, becameduringthatyearanofficerof thecompany,

by thecompanyorasubsidiary thereoforbyanyotherperson under a guarantee from or on a security provided by the company or a subsidiary thereof (including any such loans which were repaid during that year); and

(b) the amount of any loans made in manner aforesaid to any such officer or person as aforesaid at any time before the company’s financial year and outstanding at the expiration thereof.

(2) Subsection (1) shall not require the inclusion in accounts of particulars of—

(a) a loan made in the ordinary course of its business by the companyorasubsidiary thereof,where theordinarybusiness of thecompanyor,as thecasemaybe, thesubsidiary, includes the lending of money; or

(b) a loan made by the company or a subsidiary thereof to an employee of the company or subsidiary, as the case may be, if the loan does not exceed five hundred thousand dollars and is certified by the directors of the company or subsidiary, as the case may be, to have been made in accordance with any practice adopted or about to be adopted by the company or subsidiary with respect to loans to its employees,

Particulars in accounts of loans to officers, etc.

153The Companies Act, 2004 [No. ]

not being, in either case, a loan made by the company under a guarantee from or on a security provided by a subsidiary thereof or a loan made by a subsidiary of the company under a guarantee from or on a security provided by the company or any other subsidiary thereof.

(3) If in the case of any such accounts as aforesaid the requirements of this section are not complied with, it shall be theduty of the auditors of the company by whom the accounts are examined to include in their report on the balance sheet of the company, so far as they are reasonably able to do so, a statement giving the required particulars.

(4) References in this section to a subsidiary shall be taken as referring to a subsidiary at the end of the company’s financial year (whether or not a subsidiary at the date of the loan).

192.—(1) It shall be the duty of any director of a company to give notice to the company of such matters relating to himself as may be necessary for the purposes of sections 189 and 190 except so far as it relates to loans made by the company or by any other person under a guarantee from or on a security provided by the company, to an officer thereof.

(2)Any such notice given for the purposes of section 189 shall be in writing and, if it is not given at a meeting of the directors, the director giving it shall take reasonable steps to secure that it is brought up and read at the next meeting of directors after it is given.

(3) Subsection (1) shall apply—

(a) for the purposes of section 192, in relation to officers other than directors; and

(b) for the purposes of sections 191 and 192, in relation to persons who are or have at any time during the preceding five years been officers,

as it applies in relation to directors.

(4) Any person who makes default in complying with the foregoingprovisionsof this sectionshallbe liable toa finenotexceeding fifty thousand dollars.

General duty to make disclosure for purposes of sections 189 and 190.

[No. ] The Companies Act, 2004154

193.—(1)Adirector or officer of a company who is—

(a) a party to a contract or proposed contract with the company; or

(b) a director or an officer of any body or has an interest in any body that is a party to a contract or proposed contract with the company; or

(c) an associate of a person who is a party to a contract, proposed contract or has an interest in any body that is a party to a contract or proposed contract with the company,

shall disclose in writing to the company or request to have entered in theminutesofmeetingsofdirectors thenatureandextentof his interest.

(2) The contract referred to in subsection (1) shall be subject to the approval of the board of directors of the company and, subject to the provisions of the First Schedule, the director concerned shall not be present during any proceedings of the board in connection with that approval.

(3) Arecord of such contract shall be kept at the registered office of the company.

(4)Thedisclosure requiredbysubsection(1)shallbemade—

(a) in the case of a director of a company—

(i) at the meeting at which a proposed contract is first considered;

(ii) if the director was not then interested in a proposed contract, at the first meeting after he becomes so interested; or

(iii) if a person who is interested in a contract later becomes a director of the company, at the first meeting after he becomes a director;

(b) in the case of an officer of the company who is not a director—

(i) forthwithafterhebecomesaware that thecontract or proposed contract is to be considered, or has

Disclosure by directors of interest in contracts.

First Schedule.

155The Companies Act, 2004 [No. ]

been considered, at a meeting of directors of the company;

(ii) if the officer becomes interested after a contract is made, forthwith after he becomes so interested; or

(iii) if a person who is interested in a contract later becomesanofficerof thecompany, forthwithafter he becomes an officer;

(iv) if the director becomes interested after a contract is made, at the first meeting after he becomes so interested.

(5) If a contract or proposed contract is one that, in the ordinary course of the company’s business, would not require approval by the directors or shareholders of the company, a director or officer of the company shall disclose in writing to the company, or request to have entered in the minutes of meetings of directors, the nature and extent of his interest forthwith after the director or officer becomes aware of the contract or proposed contract.

(6) For the purposes of this section, a general notice to the directors of a company by a director or an officer of the company declaring that he is a director or officer of, or has an interest in, another body, and is to be regarded as interested in any type of contract with that body, is a sufficient declaration of interest in relation to any such contract.

(7) Acontract between a company and one or more of its directors or officers, or between a company and another body of which a director or officer of the company is a director or officer, or in which he has an interest, is neither void nor voidable—

(a) by reason only of that relationship;

(b) by reason only that a director with an interest in the contract is present at, or is counted to determine the presence of a quorum at a meeting of directors or a committee of directors that authorized the contract,

[No. ] The Companies Act, 2004156

if the director or officer disclosed his interest in accordance with this section and the contract was approved by the directors and was reasonable and fair to the company at the time it was approved.

(8) Where a director or officer of a company fails to disclose in accordance with this section, his interest in a material contract made by the company, the Court may, upon the application of the company, set aside the contract on such terms as the Court thinks fit.

194.—(1) Every company to which this section applies shall, in all trade catalogues, trade circulars, showcards and business letters on or in which the company’s name appears and which are issued or sent by the company to any person whether within or without the Island, state in legible characters with respect to every director being a corporation, thecorporatename,andwithrespect toeverydirectorbeinganindividual, the followingparticulars—

(a) hispresentChristianname,or the initials thereof, andpresent Surname; and

(b) any former Christian names, and Surnames:

Provided that, if special circumstances exist which render it in the opinion of the Minister expedient that such an exemption should be granted, the Minister may by order grant, subject to such conditions as may be specified in the order, exemption from the obligations imposed by this subsection.

(2) This section shall apply to—

(a) every company registered under thisAct and every existing company; and

(b) every company incorporated outside the Island which has an established place of business within the Island.

(3) Ifacompanymakesdefault incomplyingwith thissection everyofficerof thecompanywhois indefault shallbe liableonsummary conviction before a Resident Magistrate for each offence to a fine not exceeding fifty thousanddollars, and for thepurposesof this subsection, where a corporation is an officer of the company, any officer of the corporation shall be deemed to be an officer of the company:

Particulars with respect t o directors in trade catalogues, circulars, etc.

157The Companies Act, 2004 [No. ]

Provided that no proceedings shall be instituted under this section by any person other than the Director of Public Prosecutions except by, or with the consent of, the Minister.

(4) For the purposes of this section—

(a) “director” includes any person in accordance with whose directions or instructions the directors of the company are accustomed to act and the expression “officer” shall be construed accordingly;

(b) “initials” includes a recognized abbreviation of a Christian name; and

(c) “showcards” means cards containing or exhibiting articles dealt with, or samples or representations thereof.

195.—(1) Subject to this section, every company shall keep at an appropriate place—

(a) in the case of each director whose contract of service with the company is in writing, a copy of that contract;

(b) in the case of each director whose contract of service with thecompany isnot inwriting, awrittenmemorandumsetting out its terms; and

(c) in the case of each director who is employed under a contract of service with a subsidiary of the company, a copy of that contract or, if it is not in writing, a written memorandum setting out its terms.

(2) All copies and memoranda kept by a company in pursuance of subsection (1) shall be kept at the same place and for the purposes of subsection (1) the following places are appropriate—

(a) the company’s registered office;

(b) the place where its register of members is kept (if other than its registered office);

(c) its principal place of business in Jamaica.

Director's service contracts to be open to inspection.

[No. ] The Companies Act, 2004158

(3) Every company shall send notice in the prescribed form to the Registrar of the place where copies and memoranda are kept in compliance with subsection (1) and of any change in that place, save in a case in which they have at all times been kept at the company’s registered office.

(4) Subsection (1) shall not apply to a director’s contract of service with the company or with any of its subsidiaries if that contract requiredhimtoworkwhollyormainlyoutsideJamaica;but thecompany shall keep, at the same place where copies and memoranda are kept in accordance with subsection (1), a memorandum—

(a) in the case of a contract of service with the company, giving the director’s name and setting out the provisions of the contract relating to its duration;

(b) in the case of a contract of service with a subsidiary, giving the director’s name and the name and place of incorporation of thesubsidiary,andsettingout theprovisionsof thecontract relating to its duration.

(5) For the purposes of this section, a shadow director shall be treated as a director.

(6) Every copy and memorandum required to be kept by subsection (1) or (4) shall during business hours, be open to inspection by members of the company without charge.

(7) If—

(a) default is made in complying with subsection (1) or (5);

(b) an inspection required under subsection (6) is refused; or

(c) default ismadeforfourteendaysincomplyingwithsubsection (3),

the company and every officer thereof who is in default is liable on summaryconvictionbeforeaResidentMagistrate toafinenotexceeding two hundred thousand dollars.

159The Companies Act, 2004 [No. ]

(8) In the case of a refusal of an inspection of a copy or memorandum required under subsection (6), the Court may by order compel an immediate inspection thereof.

(9) Subsections (1) and (4) shall apply to a variation of a director’s contract of service as they apply to the contract.

(10) This section does not require that there be kept a copy of, or memorandum setting out the terms of, a contract (or its variation) at a time when the unexpired portion of the term for which the contract is to be in force is less than twelve months, or at a time at which the contract can, within the next ensuing twelve months, be terminated by the company without payment of compensation.

196.—(1) A person who becomes a director of a company and at the time when he does so he is interested in shares in, or debentures of, the company or any other body corporate, being the company’s subsidiaryorholdingcompanyorasubsidiaryof thecompany’sholding company, (hereinafter in this section referred to as a specified body corporate) is under obligation to notify the company in writing of—

(a) the subsistence of his interests at that time; and

(b) the number of shares of each class in, and the amount of debentures of each class of, the company or other such body corporate in which each interest of his subsists at that time.

(2) Adirector of a company is under obligation to notify the company in writing of the occurrence, while he is a director, of any of the followingevents—

(a) any event in consequence of whose occurrence he becomes, or ceases to be, interested in shares in, or debentures of the company or any specified body corporate;

(b) the entering into by him of a contract to sell any such shares or debentures;

(c) the assignment by him of a right granted to him by the company to subscribe for shares in, or debentures of, the company; or

Duty of directors to disclose shareholdings in own company.

[No. ] The Companies Act, 2004160

(d) the grant to him by a specified body corporate, of a right to subscribe for shares in, or debentures of, that specified body corporate, the exercise of such a right granted to him and the assignment by him of such a right,

and notification to the company shall state the number or amount and class of, shares or debentures involved.

(3) Subsections (1) and (2) shall have effect subject to such exceptions as may be prescribed in regulations made under this Act andtheprovisionsof theFourteenthScheduleshallhaveeffect inrelation to those subsections.

(4) Subsection (2) does not require a person to notify a company of the occurrence of any event which comes to his knowledge after he has ceased to be a director.

(5) This section shall apply to a shadow director as to a director but nothing in this section shall be construed as imposing an obligationwith respect to shares inabodycorporatewhich is thewholly owned subsidiary of another body corporate.

(6) Aperson who—

(a) fails, within the proper period, to discharge an obligation to which he is subject under subsection (1) or (2); or

(b) in purported discharge of such an obligation, makes to the company a statement which he knows to be false, or recklessly makes to it a false statement,

is guilty of an offence and liable on conviction thereof to a fine not exceeding five hundred thousand dollars or to imprisonment for a term not exceeding two years or to both such fine and imprisonment.

(7) The provisions of this section shall not apply to a director of a company licensed under the SecuritiesAct and to whom sections 54 and 55 of thatAct apply.

197.—(1) Every company shall keep a register for the purposes of section 196.

(2) Acompany is under obligation to enter in the register, against a director’s name, the following information—

(a) any information received by the company from that director, beinginformationgiveninfulfilmentofanobligationimposed on him by section 196 and the date of the entry;

Register of interests notified under section 196.

Fourteenth Schedule.

161The Companies Act, 2004 [No. ]

(b) information concerning the grant by a company to that director of a right to subscribe for shares in, or debentures of, the company, that is to say—

(i) the date on which the right was granted;

(ii) the period during which, and a time at which, it is exercisable;

(iii) the consideration for the grant (or, if there is not consideration, that fact); and

(iv) the description of shares or debentures involved and the number or amount of them, and the price to be paid for them (or the consideration, if otherwise than in money).

(3) Whenever such a right as mentioned in subsection (2) (b) is exercised by a director, the company is under obligation to enter in theregisteragainsthisnamethat fact (identifyingtheright), thenumber or amount of shares or debentures in respect of which it is exercised and, if they were registered in his name, that fact and, if not, the name or names of the person or persons in whose name or names they were registered and, if they were registered in the names of two or more persons, the number or amount of the shares or debentures registered in the name of each of them.

(4) Part IV of the Fourteenth Schedule shall have effect with respect to the register to be kept under this section, the way in which entries in it are to be made, the right of inspection and generally.

(5) For the purposes of this section, a shadow director shall be treated as a director.

(6) The company may, on giving notice by advertisement in a daily newspaper circulating in the Island, close the register for any time not exceeding a total of thirty days in each year.

198.—(1) The following provisions of this section shall apply with respect to defaults in complying with, and contraventions of, section 197 and Part IV of the Fourteenth Schedule.

Fourteenth Schedule.

Sanctions for non- compliance.

[No. ] The Companies Act, 2004162

(2) If default is made in complying with—

(a) subsection (1), (2) or (3) of section 197;

(b) paragraph 18, 19 or 25 of the Fourteenth Schedule,

the company and every officer thereof who is in default is liable to a fine notexceeding twothousanddollars in respectofeverydayduringwhich the default continues.

(3) If an inspection of the register required under paragraph 22 of the Fourteenth Schedule is refused, or a copy required under paragraph 23 is not sent within the proper period, the company and every officer thereof who is in default is liable to a daily default fine not exceeding two thousand dollars in respect of every day during which the default continues.

(4) If default is made for fourteen days in complying with paragraph 24 of the Fourteenth Schedule (notice to the Registrar of where register is kept), the company and every officer thereof who is in default is liable to a fine not exceeding four thousand dollars in respect of every day during which the default continues.

(5) If default is made in complying with paragraph 23 of the FourteenthSchedule (register tobeproducedatannualgeneralmeeting), the company and every officer thereof is liable to a default fine not exceeding two thousand dollar.

(6) In the case of a refusal of an inspection of the register required under paragraph 22 of the Fourteenth Schedule, the Court may, by order compel an immediate inspection of it; and in the case of failure to send, within the proper period, a copy required under paragraph 26, the Court may, by order, direct that the copy be sent to the person requiring it.

199.—(1) For the purpose of section 196—

(a) an interest of the wife, husband or minor child of a director ofacompany(notbeingherselforhimself adirector thereof) in shares or debentures shall be treated as the director’s interest;

Application of section 194 to spouse and child.

Fourteenth Schedule.

163The Companies Act, 2004 [No. ]

(b) a contract, assignment or right of subscription entered into, exercised or made by, or a grant made to, the wife, husband or minor child of a director of a company (not being herself or himself a director thereof) shall be treated as having been entered into, exercised or made by, or, as the case may be, as having been made to, the director.

(2) Adirector of a company is under obligation to notify the company in writing of the occurrence while he or she is a director, of either of the following events, namely—

(a) the grant by the company to his or her spouse or minor child, of a right to subscribe for shares in, or debentures of, the company; and

(b) the exercise by his or her spouse or minor child of such a right granted by the company to the wife, husband or minor child.

(3)Anotice given to the company under subsection (2) shall state—

(a) in the case of the grant of a right, the like information as is required by section 196 to be stated by the director on the grant tohimbyanotherbodycorporateofa right to subscribe for shares in, or debentures of, that other body corporate; and

(b) in the case of the exercise of a right, the like information as is required by that section to be stated by the director on the exercise of a right granted to him by another body corporate to subscribe for shares in, or debentures of, that other body corporate.

(4) An obligation imposed by subsection (2) on a director shall be fulfilled by him before the end of five days beginning with the day following that on which the occurrence of the event giving rise to it comes to his knowledge.

(5) A person who—

(a) fails to fulfil,within theproperperiod, anobligation towhich he is subject under subsection (4) is guilty of an offence and

[No. ] The Companies Act, 2004164

liable on conviction to a fine not exceeding two hundred thousand dollars; or

(b) in purported fulfilment of such an obligation, makes to a company a statement which he knows to be false, or recklessly makes to a company a false statement, is guilty of an offence and liable on conviction thereof to a fine not exceeding five hundred thousand dollars or to imprisonment for a term not exceeding two years or to both such fine and imprisonment.

(6) For the purposes of section 197, an obligation imposed on a director by this section shall be treated as if it were imposed by section 196.

200. If in the case of any company provision is made by the articles or by any agreement entered into between any person and the company for empowering a director or manager of the company to assign his office as such to another person, any assignment of office made in pursuance of that provision shall, notwithstanding anything to the contrary contained in that provision, be of no effect unless and until it is approved by a special resolution of the company.

201.—(1)Except in respectofanactionbyoronbehalfofa company or body corporate to obtain a judgment in its favour, a company may indemnify—

(a) a director or officer of the company or any person employed by the company as an auditor;

(b) a former director, officer or auditor of the company; or

(c) a person who acts or acted at the company’s request as a director or officer of a body corporate of which the company is or was a shareholder or creditor,

and his legal representatives, against all costs, charges and expenses (including an amount paid to settle an action or satisfy a judgement) reasonably incurred by him in respect of any civil, criminal or administrative action or proceeding to which he is made a party by reason of being, or having been, a director or officer of that company

Provisions as to assignment of office by directors.

Indemnifying directors, etc.

165The Companies Act, 2004 [No. ]

or body corporate, or any person employed by a company or body corporate as an auditor.

(2) Subsection (1) does not apply unless the director or officer to be so indemnified—

(a) acted honestly and in good faith with a view to the best interests of the company; and

(b) in thecaseofacriminaloradministrativeactionorproceeding that is enforced by a monetary penalty, had reasonable grounds for believing that his conduct was lawful.

(3) Theprovisionsofsubsection(2) shall apply toanyperson employed to the company as an auditor if the act or omission for which he is to be indemnified did not arise due to a breach of duty on his part.

202. Acompany may with the approval of the Court indemnify a person referred to in section 201 in respect of an action—

(a) by or on behalf of the company or body corporate to obtain a judgment in its favour; and

(b) to which he is made a party by reason of being or having been a director or an officer of the company or body corporate,

against all costs, charges and expenses reasonably incurred by him in connectionwith theaction, ifhefulfils theconditionssetout insubsection (2) of section 201.

203. Notwithstanding anything in section 201 or 202, a person described in section 201 is entitled to indemnity from the company in respect of all costs, charges and expenses reasonably incurred by him in connection with the defence of any civil, criminal or administrative action or proceeding to which he is made a party by reason of being, or having been, a director or officer of the company or body corporate, if the person seeking indemnity—

(a) was substantially successful on the merits in his defence of the action or proceeding;

For derivative action.

Right to indemnity.

[No. ] The Companies Act, 2004166

(b) qualified in accordance with the standards set out in section 201 or 202; and

(c) is fairly and reasonably entitled to indemnity.

204. Acompanymaypurchaseandmaintain insurance for thebenefit of any person referred to in section 201 against any liability incurred by him in his capacity as a director or officer of the company other than liability for fraud.

205.—(1) A company or person referred to in section 201 may apply to the Court for an order approving an indemnity under section 202; and the Court may so order and make any further order it thinks fit.

(2) Anapplicantunder subsection (1) shallgive theRegistrar notice of the application; and the Registrar may appear and be heard in person or by an attorney-at-law.

(3) An application under subsection (1) in the case of a publiccompany, shallgive to theFinancialServicesCommissionnotice of the application, and the Financial Services Commission may appear and be heard.

(4) Upon an application under subsection (1), the Court may order notice to be given to any interested person; and that person may appear and be heard in person or by an attorney-at-law.

Arrangements and Reconstructions

206.—(1)Whereacompromiseorarrangement isproposedbetween a company and its creditors or any class ot them, or with creditors between the company and its members or any class of them, the Court may, on the application in a summary way of the company or of any creditor or member of the company, or, in the case of a company being wound up, of the liquidator, order a meeting of the creditors or class of creditors, or of the members of the company or class of members, as the case may be, to be summoned in such manner as the Court directs.

(2) If a majority in number representing three-fourths in value of the creditors or class of creditors, or members or class of members, as the case may be, present and voting either in person or by proxy at the meeting agree to any compromise or arrangement, the compromiseorarrangement shall, if sanctionedby theCourt,bebinding on all the creditors or the class of creditors, or on the members or class

Insurance of directors, etc.

Court approval of indemnity.

Power to compromise with creditors and members.

167The Companies Act, 2004 [No. ]

of members, as the case may be, and also on the company or, in the case of a company in the course of being wound up, on the liquidator and contributories of the company.

(3) An order made under subsection (2) shall have no effect until a copy of the order has been delivered to the Registrar for registration, and a copy of every such order shall be annexed to every copy of the articles of the company issued after the order has been made.

(4) Ifacompanymakesdefault incomplyingwithsubsection (3) the company and every officer of the company who is in default shall be liable to a fine not exceeding one thousand dollars for each copy in respect of which default is made.

(5) In this section and in section 207—

“arrangement” includes a reorganization of the share capital of the company by the consolidation of shares of different classes or by the division of shares of different classes or by both those methods;

“company” means any company liable to be wound up under this Act.

207.—(1) Where a meeting of creditors or any class of creditors or of members or any class of members is summoned under section 206 there shall—

(a) with every notice summoning the meeting which is sent to a creditor or member, be sent also a statement explaining the effect of the compromise or arrangement and in particular stating any material interests of the directors of the company, whether as directors or as members or as creditors of the company or otherwise, and the effect thereon, of the compromise or arrangement, in so far as it is different from the effect on the like interests of other persons; and

(b) in every notice summoning the meeting which is given by advertisement, be included either such a statement as aforesaid or a notification of the place at which and the manner in which creditors or members entitled to attend the meeting may obtain copies of such a statement as aforesaid.

Information as to compromises with creditors and members.

[No. ] The Companies Act, 2004168

(2) Where the compromise or arrangement affects the rights of debenture holders of the company, the statement shall give the like explanation as respects the trustees of any deed for securing the issue of the debentures as it is required to give as respects the company’s directors.

(3) Where a notice given by advertisement includes a notification that copies of a statement explaining the effect of the compromise or arrangement proposed can be obtained by creditors or members entitled to attend the meeting, every such creditor or member shall, on making application in the manner indicated by the notice, be furnished by the company free of charge with a copy of the statement.

(4) Where a company makes default in complying with any requirements of this section, the company and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars, and for the purpose of this subsection any liquidator of the company and any trustee of a deed for securing the issue of debentures of the company shall be deemed to be an officer of the company:

Provided that a person shall not be liable under this subsection if that person shows that the default was due to the refusal of any other person, being a director or trustee for debenture holders, to supply the necessary particulars as to his interests.

(5) It shall be the duty of any director of the company and of any trustee for debenture holders of the company to give notice to the company of such matters relating to himself as may be necessary for the purposes of this section, and any person who makes default in complying with this subsection shall be liable to a fine not exceeding fifty thousand dollars.

208.—(1) Where an application is made to the Court under section 206 for the sanctioning of a compromise or arrangement proposed between a company and any such persons as are and mentioned in that section, and it is shownto theCourt that thecompromiseorarrangement has been proposed for the purposes of or in connection with a scheme for thereconstructionofanycompanyorcompaniesor theamalgamation

Provisions for facilitating reconstruction and amalgamation of companies.

169The Companies Act, 2004 [No. ]

of any two or more companies, and that under the scheme the whole or any part of the undertaking or the property of any company concerned in the scheme (in this section referred to as “a transferor company”) is to be transferred to another company (in this section referred to as “the transferee company”) the Court may, either by the order sanctioning the compromise or arrangement or by any subsequent order, make provision for all or any of the following matters—

(a) the transfer to the transferee company of the whole or any part of the undertaking and of the property or liabilities of any transferor company;

(b) the allotting or appropriation by the transferee company of any shares, debentures, policies, or other like interests in that company which under the compromise or arrangement are to be allotted or appropriated by that company to or for any person;

(c) the continuation by or against the transferee company of any legal proceedings pending by or against any transferor company;

(d) the dissolution, without winding up, of any transferor company;

(e) the provision to be made for any person, who within such time and in such manner as the Court may direct, dissent from the compromise or arrangement;

(f) such incidental, consequential and supplemental matters as are necessary to secure that the reconstruction or amalgamation shall be fully and effectively carried out.

(2) Whereanorderunder thissectionprovidesfor the transfer of property or liabilities, that property shall, by virtue of the order, be transferred to and vest in, and those liabilities shall, by virtue of the order, be transferred to and become the liabilities of, the transferee company, and in the case of any property, if the order so directs, freed from any charge which is by virtue of the compromise or arrangement to cease to have effect.

[No. ] The Companies Act, 2004170

(3) Where an order is made under this section, every company in relation to which the order is made shall cause a copy thereof to be delivered to the Registrar for registration within seven days after the making of the order, and if default is made in complying with this subsection, the company and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

(4) In this section the expression “property” includes property, rights and powers of every description, and the expression “liabilities” includesduties.

(5) Notwithstanding the provisions of subsection (5) of section 206, the expression “company” in this section does not include any company other than a company within the meaning of thisAct.

209.—(1) Where a scheme or contract involving the transfer of shares or any class of shares in a company (in this section referred to as “the transferor company”) to another company, whether a company within the meaning of thisAct or not (in this section referred to as “the transferee company”), has, within four months after the making of the offer in that behalf by the transferee company been approved by the holders of not less than nine-tenths in value of the shares whose transfer is involved (other than shares already held at the date of the offer by, or by a nominee for, the transferee company or its subsidiary)—

(a) the transferee company may, at any time within two months after the expiration of the four months, give notice in the prescribed manner to any dissenting shareholder that it desires to acquire his shares; and

(b) when such a notice is given the transferee company shall, unless on an application made by the dissenting shareholder within one month from the date on which the notice was given the Court thinks fit to order otherwise, be entitled and bound to acquire those shares on the terms on which, under the scheme or contract, the shares of the approving shareholders are to be transferred to the transferee company:

Power to acquire shares of shareholders dissenting from scheme or contract approved by majority.

171The Companies Act, 2004 [No. ]

Provided that where shares in the transferor company of the same class or classes as the shares whose transfer is involved are already held as aforesaid to a value greater than one-tenth of the aggregate of their value and that of the shares (other than those already held as aforesaid) whose transfer is involved, the foregoing provisions of this subsection shall not apply unless—

(a) the transferee company offers the same terms to all holders of the shares (other than those already held as aforesaid) whose transfer is involved, or, where those shares include shares of different classes, of each class of them; and

(b) the holders who approve the scheme or contract, besides holding not less than nine-tenths in value of the shares (other than those already held as aforesaid) whose transfer is involved, are not less than three-fourths in number of the holders of those shares.

(2) Where, in pursuance of any such scheme or contract as aforesaid, shares in a company are transferred to another company or its nominee, and those shares together with any other shares in the firstmentioned company held by, or by a nominee for, the transferee company or its subsidiary at the date of the transfer comprise or include nine-tenths in value of the shares in the firstmentioned company or of any class of those shares, then—

(a) the transferee company shall within one month from thedate of the transfer (unless on a previous transfer in pursuance of the scheme or contract it has already complied with this requirement)givenoticeof that fact in theprescribedmanner to the holders of the remaining shares or of the remaining shares of that class, as the case may be, who have not assented to the scheme or contract; and

(b) any such holder may within three months from the giving of the notice to him require the transferee company to acquire the shares in question,

and where a shareholder gives notice under paragraph (b) of this sub- section with respect to any shares, the transferee company shall be

[No. ] The Companies Act, 2004172

entitled and bound to acquire those shares on the terms on which under the scheme or contract the shares of the approving shareholders were transferred to it, or on such other terms as may be agreed or as the Court on the application of either the transferee company or the share- holder thinks fit to order.

(3) Where a notice has been given by the transferee com- pany under subsection (1) and the Court has not, on an application made by the dissenting shareholder, ordered to the contrary, the trans- feree company shall, on the expiration of one month from the date on which the notice has been given, or, if an application to the Court by the dissenting shareholder is then pending, after that application has been disposed of—

(a) transmit a copy of the notice to the transferor company together with an instrument of transfer executed on behalf of the shareholder by any person appointed by the transferee company and on its own behalf by the transferee company; and

(b) pay or transfer to the transferor company the amount or other consideration representing the price payable by the transferee company for the shares which by virtue of this section that company is entitled to acquire,

and the transferor company shall thereupon register the transferee company as the holder of those shares:

Provided that an instrument of transfer shall not be required for any share for which a share warrant is for the time being outstanding.

(4) Any sums received by the transferor company under this section shall be paid into a separate bank account, and any such sums and any other consideration so received shall be held by that company on trust for the several persons entitled to the shares in respect of which those sums or other consideration were respectively received.

(5) In this section the expression “dissenting shareholder” includes a shareholder who has not assented to the scheme or contract and any shareholder who has failed or refused to transfer his shares to the transferee company in accordance with the scheme or contract.

173The Companies Act, 2004 [No. ]

(6) In relation to an offer made by the transferee company to shareholders of the transferor company before the appointed day, this section shall have effect—

(a) with the substitution, in subsection (1), for the words “the shares whose transfer is involved (other than shares already held at the date of the offer by, or by a nominee for, the transferee company or its subsidiary),” of the words “the shares affected” and with the omission of the proviso to that subsection;

(b) with the omission of subsection (2); and

(c) with the omission, in subsection (3) of the words “together with an instrument of transfer executed on behalf of the shareholder by any person appointed by the transferee company and on its own behalf by the transferee company” and of the proviso to that subsection.

210.—(1) Without prejudice to the operation of sections 206 to 209—

(a) the provisions of subsection (2) of this section shall apply in any case where a compromise or arrangement is proposed in relation to a company which is a member of a group of connected bodies corporate in respect of any or all of which a compromise or arrangement is proposed; and

(b) for the purposes of this section, a group of connected bodies corporate shall be deemed to exist where the same persons or individuals have the effective control, direction or management of the members of the group or have had such effectivecontrol,directionormanagementatany timewithin the period of twenty-four months immediately preceding—

(i) thedateonwhich thecompromiseorarrangement is proposed; or

(ii) the date of appointment, pursuant to any enactment, of a temporary manager or liquidator, as the case may be, in relation to any member of the group.

Scheme of arrangement re company and connected person.

[No. ] The Companies Act, 2004174

(2) Acompromise or arrangement in relation to a company may provide that—

(a) the assets and liabilities of the company and any or all of the connected bodies corporate be combined as if the company and the connected person were a single undertaking; and

(b) the members and creditors of the company and any or all of the connected bodies corporate were members and creditors of that single undertaking.

211. The Court may, in respect of an application for the sanctioning of a compromise or arrangement in respect of a company, order that the assets of that company be combined with the assets of any other body corporate, if the Court is satisfied that—

(a) the assets of the company are so intermingled with the assets of the other body corporate that it is just and equitable that they should be treated as a single undertaking; or

(b) the same persons or individuals have the effective control, directionormanagementof thecompanyand theotherbody corporate or have had such effective control, direction or management at any time during the period of twenty-four months immediatelypreceding—

(i) thedateonwhich thecompromiseorarrangement is proposed; or

(ii) thedateofappointmentpursuant toanyenactment of a temporary manager or liquidator, as the case may be, in relation to the company or other body corporate.

Complainant Remedies

212.—(1) Subject to subsection (2), a complainant may, for the purpose of prosecuting, defending or discontinuing an action on behalf of a company, apply to the Court for leave to bring a derivative action in the name and on behalf of the company or any of its subsidiaries, or intervene in an action to which any such company or any of its subsidiaries is a party.

Power of Court to order pooling of assets.

Derivative actions.

175The Companies Act, 2004 [No. ]

(2) No action may be brought, and no intervention in an action may be made under subsection (1) unless the Court is satisfied that—

(a) the complainant has given reasonable notice to the directors of the company or its subsidiary of his intention to apply to theCourtundersubsection(1) if thedirectorsof thecompany or its subsidiary do not bring, diligently prosecute or defend, or discontinue, the action;

(b) the complainant is acting in good faith; and

(c) it appears to be in the interests of the company or its subsidiary that the action be brought, prosecuted, defended or discontinued.

(3) In this section and section 213 and 213A, “complainant” means—

(a) a shareholder or former shareholder of a company or an affiliatedcompany;

(b) a debenture holder or former debenture holder of a company or an affiliated company;

(c) adirectororofficeror formerdirectororofficerofacompany or an affiliated company.

213.—(1) The Court may, in connection with an action brought or intervenedinundersection212,makesuchorderas it thinksfit, including an order—

(a) authorizingthecomplainant, theRegistraroranyotherperson to control the conduct of the action;

(b) giving directions for the conduct of the action;

(c) directing that any amount adjudged payable by a defendant in the action be paid, in whole or in part, directly to former and present shareholders or debenture holders of the company or its subsidiary, instead of to the company or its subsidiary; or

(d) requiring the company or its subsidiary to pay reasonable legal fees incurredby thecomplainant inconnectionwith the action.

Court powers.

[No. ] The Companies Act, 2004176

(2) An action brought or intervened in under section 212 shall not be stayed or dismissed by reason only that it is shown that an alleged breach of a right or duty owed to the company or its subsidiary has been or may be approved by the shareholders, but evidence of approval by the shareholders may be taken into account by the Court in making an order under that section.

213A.—(1) A complainant may apply to the Court for an order under this section.

(2) If upon an application under subsection (1), the Court is satisfied that in respect of a company or of any of its affiliates—

(a) any act or omission of the company or any of its affiliates effects a result;

(b) the business or affairs of the company or any of its affiliates are or have been carried on or conducted in a manner;

(c) the powers of the directors of the company or any of its affiliates are or have been exercised in a manner,

that isoppressiveorunfairlyprejudicial to, anyshareholderordebenture holder, creditor, director or officer of the company, the Court may make an order to rectify the matters complained of.

(3) The Court may, in connection with an application under this section make any interim or final order it thinks fit, including an order—

(a) restraining the conduct complained of;

(b) appointing a receiver or receiver-manager;

(c) to regulate a company's affairs by amending its articles or by-laws, or creating or amending a unanimous shareholder agreement;

(d) directing an issue or exchange of shares or debentures;

(e) appointing directors in place of, or in addition to, all or any of the directors then in office;

Remedy in case of oppression.

177The Companies Act, 2004 [No. ]

(f) directing a company, subject to subsection (4), or any other person to purchase the shares or debentures of a holder thereof;

(g) directing a company, subject to subsection (4), or any other person to pay to a shareholder or debenture holder any part of the moneys paid by him for his shares or debentures;

(h) varying or setting aside a transaction or contract to which a company is a party, and compensating the company or any other party to the transaction or contract;

(i) requiring a company, within the time specified by the Court, to produce to the Court or an interested person, financial statements or an accounting in such forms as the Court may determine;

(j) compensating an aggrieved person;

(k) directing rectification of the registers or other records of the company;

(l) liquidatinganddissolving thecompany;

(m) directing an investigation to be made; or

(n) requiring the trial of any issue.

(4) A company shall not make a payment to a shareholder under paragraph (f) or (g) of subsection (3) if there are reasonable grounds for believing that—

(a) thecompanyisunableorwould,after thatpayment,beunable to pay its liabilities as they become due; or

(b) the realizable value of the company's assets would thereby be less than the aggregate of its liabilities.

[No. ] The Companies Act, 2004178

PART V—WINDING UP

(i)PRELIMINARY

Modes of Winding Up

214.—(1) The winding up of a company may be either—

(a) by the Court; or

(b) voluntary;or

(c) subject to the supervision of the Court.

(2) The provisions of thisAct with respect to winding up apply, unless the contrary appears, to the winding up of a company in any of those modes.

Contributories

215.—(1) In the event of a company being wound up, every present and past member shall be liable to contribute to the assets of the company to an amount sufficient for payment of its debts and liabilities, and the costs, charges, and expenses of the winding up, and for the adjustmentof the rightsof thecontributoriesamong themselves, subject to the followingqualifications—

(a) a past member shall not be liable to contribute if he has ceased to be a member for one year or upwards before the commencement of the winding up;

(b) a past member shall not be liable to contribute in respect of anydebtor liabilityof thecompanycontractedafterheceased to be a member;

(c) a past member shall not be liable to contribute unless it appears to the Court that the existing members are unable to satisfy the contributions required to be made by them in pursuance of thisAct;

(d) in the case of a company limited by shares, no contribution shall be required from any member exceeding the amount, if any, unpaid on the shares in respect of which he is liable as a present or past member;

Modes of winding up.

Liability as contributories of present and past members.

179The Companies Act, 2004 [No. ]

(e) in thecaseofacompanylimitedbyguarantee,nocontribution shall, subject to the provisions of subsection (2), be required from any member exceeding the amount undertaken to be contributed by him to the assets of the company in the event of its being wound up;

(f) nothing in thisAct shall invalidateanyprovisioncontained in anypolicyof insuranceorothercontractwhereby the liability of individual members on the policy or contract is restricted, or whereby the funds of the company are alone made liable in respect of the policy or contract;

(g) a sum due to any member of a company, in his character of a member, by way of dividends, profits or otherwise, shall not be deemed to be a debt of the company, payable to that member in a case of competition between himself and any other creditor not a member of the company, but any such sum may be taken into account for the purpose of the final adjustment of the rights of the contributories among themselves.

(2) In the winding up of a company limited by guarantee which has a share capital, every member of the company shall be liable, in addition to the amount undertaken to be contributed by him to theassetsof thecompanyintheeventof itsbeingwoundup, tocontribute to the extent of any sums unpaid on any shares held by him.

216. The term“contributory”meanseveryperson liable tocontribute to the assets of a company in the event of it being wound up, and for the purposes of all proceedings for determining, and all proceedings prior to the final determination of, the persons who are to be deemed contributories, includes any person alleged to be a contributory.

217. The liability of a contributory shall create a debt in the nature of a specialty accruing due from him at the time when his liability commenced, but payable at the times when calls are made for enforcing theliability.

218.—(1) If a contributory dies either before or after he has been placed on the list of contributories, his personal representatives shall be liable in a due course of administration to contribute to the assets of the

Contributories in case of death of member.

Definition of contributory.

Nature of liability of contributory.

[No. ] The Companies Act, 2004180

company in discharge of his liability and shall be contributories accordingly.

(2) If the personal representatives make default in paying any money ordered to be paid by them, proceedings may be taken for administering theestateof thedeceasedcontributory,andforcompelling payment out of the money due.

219. If a contributory becomes bankrupt, either before or after he has been placed on the list of contributories—

(a) the Trustee shall represent him for all the purposes of the windingup,andshallbeacontributoryaccordingly, andmay be called on to admit to proof against the estate of the bankrupt, or otherwise to allow to be paid out of his assets in due course of law, any money due from the bankrupt in respect of his liability to contribute to the assets of the company; and

(b) there may be proved against the estate of the bankrupt the estimated value of his liability to future calls as well as calls already made.

(ii) WINDING UP BY THE COURT

Cases in which Company may be wound up by Court

220. Acompany may be wound up by the Court if—

(a) the company has by special resolution resolved that the company be wound up by the Court;

(b) default is made in delivering the statutory report to the Registrar or in holding the statutory meeting;

(c) the company does not commence its business within a year from its incorporation, or suspends its business for a whole year;

(d) the company is unable to pay its debts;

(e) the Court is of opinion that it is just and equitable that the company should be wound up.

Contributories in case of bankruptcy of member.

Circumstances in which companies may be wound up by Court.

181The Companies Act, 2004 [No. ]

221. Acompany shall be deemed to be unable to pay its debts—

(a) if a creditor, by assignment or otherwise, to whom the company is indebted in a sum exceeding five hundred thousand dollars then due, has served on the company, by leaving it at the registered office of the company, a demand under his hand requiring the company to pay the sum so due, and the company has for three weeks thereafter neglected to pay the sum, or to secure or compound for it to the reasonable satisfaction of the creditor; or

(b) if execution or other process issued on a judgment, decree or order of any Court in favour of a creditor of the company is returned unsatisfied in whole or in part; or

(c) if it isproved to thesatisfactionof theCourt that thecompany is unable to pay its debts, and, in determining whether a company is unable to pay its debts, the Court shall take into account the contingent and prospective liabilities of the company.

Petition for Winding Up and Effects thereof

222.—(1) An application to the Court for the winding up of a company shall be by petition, presented subject to the provisions of this section either by the company, or by any creditor or creditors (including any contingent or prospective creditor or creditors) contributory or contributories, or by all or any of those parties, together or separately:

Provided that—

(a) a contributory shall not be entitled to present a winding up petition unless the shares in respect of which he is a contributory, or some of them, either were originally allotted to him or have been held by him, and registered in his name, for at least six months during the eighteen months before the commencement of the winding up, or have devolved on him through the death of a former holder; and

Definition of inability to pay debts.

Provisions as t o applications for winding up.

[No. ] The Companies Act, 2004182

(b) awindinguppetitionshall not, if thegroundof thepetition is default in delivering the statutory report to the Registrar or in holding the statutory meeting, be presented by any person except a shareholder, nor before the expiration of fourteen days after the last day on which the meeting ought to have been held; and

(c) the Court shall not give a hearing to a winding up petition presented by a contingent or prospective creditor until such security for costs has been given as the Court thinks reasonable and until a prima facie case for winding up has been established to the satisfaction of the Court; and

(d) in a case falling within subsection (4) of section 165, a winding up petition may be presented by the Minister.

(2) Where a company is being wound up voluntarily or subject to supervision, a winding up petition may be presented by the Trustee as well as by any other person authorized in that behalf under the other provisions of this section, but the Court shall not make a winding up order on the petition unless it is satisfied that the voluntary winding up or winding up subject to supervision cannot be continued with due regard to the interests of the creditors or contributories.

223.—(1) On hearing a winding up petition the Court may dismiss it, or adjourn the hearing conditionally or unconditionally, or make any interim order, or any other order that it thinks fit, but the Court shall not refuse to make a winding up order on the ground only that the assets of the company have been mortgaged to an amount equal to or in excess of those assets, or that the company has no assets.

(2) Where the petition is presented by members of the company as contributories on the ground that it is just and equitable that the company should be wound up, the Court, if it is of opinion—

(a) that the petitioners are entitled to relief either by winding up the company or by some other means; and

(b) that in the absence of any other remedy it would be just and equitable that the company should be wound up,

Power of Court on hearing petition.

183The Companies Act, 2004 [No. ]

shall make a winding up order, unless it is also of the opinion both that some other remedy is available to the petitioners and that they are acting unreasonably in seeking to have the company wound up instead of pursuing that other remedy.

(3) Where the petition is presented on the ground of default in delivering the statutory report to the Registrar in holding the statutory meeting, the Court may—

(a) insteadofmakingawindinguporder,direct that thestatutory report shall be delivered or that a meeting shall be held; and

(b) order the costs to be paid by any persons who, in the opinion of the Court, are responsible for the default.

224. At any time after the presentation of a winding up petition, and before a winding up order has been made, the company, or any creditor orcontributory,may,whereanyactionorproceeding ispendingagainst the company, apply to the Court to restrain further proceedings in the action or proceeding, and the Court may stay or restrain the proceedings accordingly on such terms as it thinks fit.

225. In a winding up by the Court, any disposition of the property of the company, including things in action, and any transfer of shares, or alteration in the status of the members of the company, made after the commencement of the winding up, shall, unless the Court otherwise orders, be void.

226. Where any company is being wound up by the Court, any attachment, sequestration, distress, or execution put in force against the estate or effects of the company after the commencement of the winding up shall be void to all intents.

Commencement of Winding Up

227.—(1)Wherebefore thepresentationofapetition for thewinding up of a company by the Court a resolution has been passed by the company for voluntary winding up, the winding up of the company shall be deemed to have commenced at the time of passing of the resolution, and unless the Court, on proof of fraud or mistake, thinks fit otherwise to direct, all proceedings taken in the voluntary winding up shall be deemed to have been validly taken.

Power to stay or restrain proceedings against company.

Avoidance of disposi- tions of property, etc. after commence- ment of winding up.

Avoidance of attach- ments, etc.

Commence- ment of winding up by the Court.

[No. ] The Companies Act, 2004184

(2) In any other case, the winding up of a company by the Court shall be deemed to commence at the time of the presentation of the petition for the winding up.

Consequences of Winding Up Order

228.—(1) On the making of a winding up order, a copy of the order shall forthwith be forwarded by the company, or otherwise as may be prescribed, to the Registrar, who shall make a minute thereof in his books relating to the company.

(2) If default is made in forwarding a copy of a winding up order to the Registrar as required by subsection (1), every officer of the company or other person who knowingly and wilfully authorizes or permits the default shall be liable to a fine not exceeding fifty thousand dollars.

229. When a winding up order has been made, or a provisional liquidator has been appointed, no action or proceeding shall be proceeded with or commenced against the company except by leave of the Court, and subject to such terms as the Court may impose.

230. An order for winding up a company shall operate in favour of all the creditors and of all the contributories of the company as if made on the joint petition of a creditor and of a contributory.

Trustee in Bankruptcy

231. For the purposes of this Act, the term “Trustee” means the Trustee in Bankruptcy attached to the Court for bankruptcy purposes as provided for in section 14 of the BankruptcyAct.

232.—(1) Where the Court has made a winding up order or appointed a provisional liquidator, there shall, unless the Court thinks fit to order otherwise and so orders, be made out and submitted to the Trustee a statement as to the affairs of the company in the prescribed form, verified by affidavit, and showing the particulars of its assets, debts and liabilities, the names, residences, and occupations of its creditors, the securities held by them respectively, the dates when the securitieswere respectivelygiven, andsuch furtherorother information as may be prescribed or as the Trustee may require.

Copy of order to be forwarded to Registrar.

Actions stayed on winding up order.

Effect of winding up order.

Trustee in Bankruptcy to be Trustee for winding up purposes.

Statement of company's affairs to be submitted to trustees.

185The Companies Act, 2004 [No. ]

(2) The statement shall be submitted and verified by one or more of the persons who are at the relevant date the directors and by the person who is at the date the secretary or other chief officer of the company, or by such of the persons hereinafter mentioned in this subsection as the Trustee, subject to the direction of the Court, may require to submit and verify the statement, that is to say, persons—

(a) who are or have been directors or officers of the company;

(b) who have taken part in the formation of the company at any time within one year before the relevant date;

(c) who are in the employment of the company, or have been in the employment of the company within that year, and are in the opinion of theTrustee capable of giving the information required;

(d) who are or have been within that year officers of or in the employment of a company, which is, or within the said year was,anofficerof thecompany towhich thestatement relates.

(3) The statement shall be submitted within fourteen days from the relevant date, or within such extended time as the Trustee or the Court may for special reasons appoint.

(4) Anypersonmakingorconcurringinmakingthestatement and affidavit required by this section shall be allowed, and shall be paid by the Trustee or provisional liquidator, as the case may be, out of the assets of the company, such costs and expenses incurred in and about the preparation and making of the statement and affidavit as theTrustee may consider reasonable, subject to an appeal to the Court.

(5) If any person, without reasonable excuse, makes default in complying with the requirements of this section, he shall be liable to a fine not exceeding two thousand dollars for every day during which the default continues.

(6) Any person stating himself in writing to be a creditor or contributory of the company shall be entitled by himself or by his agent at all reasonable times, on payment of the prescribed fee, to inspect the statement submitted in pursuance of this section, and to a copy thereof or extract therefrom.

[No. ] The Companies Act, 2004186

(7) Anypersonuntruthfullysostatinghimself tobeacreditor or contributory shall be guilty of a contempt of court and shall, on the applicationof the liquidatororof theTrustee,bepunishableaccordingly.

(8) In this section the expression “the relevant date” means in a case where a provisional liquidator is appointed, the date of his appointment, and, in a case where no such appointment is made, the date of the winding up order.

233.—(1) In a case where a winding up order is made, the Trustee shall, as soon as practicable after receipt of the statement to be submitted under section 232, or, in a case where the Court orders that no statement shall be submitted, as soon as practicable after the date of the order, submit a preliminary report to the Court—

(a) as to the amount of capital issued, subscribed, and paid up, and the estimated amount of assets and liabilities; and

(b) if the company has failed, as to the causes of the failure; and

(c) whether in his opinion further inquiry is desirable as to any matter relating to the promotion, formation or failure of the company, or the conduct of the business thereof.

(2) The Trustee may also, if he thinks fit, make a further report, or further reports, stating the manner in which the company was formed and whether in his opinion any fraud has been committed by any person in its promotion or formation, or by any director or other officer of the company in relation to the company since the formation thereof, and any other matters which in his opinion it is desirable to bring to the notice of the Court.

(3) If theTrustee states inanysuch further report asaforesaid that in his opinion a fraud has been committed as aforesaid, the Court shall have the further powers provided in sections 265 and 266.

Report by Trustee.

187The Companies Act, 2004 [No. ]

Liquidators

234. For the purpose of conducting the proceedings in winding up a company and performing such duties in reference thereto as the Court may impose, the Court may appoint a liquidator or liquidators.

235.—(1) Subject to the provisions of this section, the Court may appoint a liquidator provisionally at any time after the presentation of a winding up petition, and either the Trustee or any other fit person may be appointed.

(2) Where a liquidator is provisionally appointed by the Court, theCourtmaylimitandrestricthispowersbytheorderappointing him.

236.—(1) The following provisions with respect to liquidators shall have effect on a winding up order being made—

(a) theTrusteeshallbyvirtueof hisofficebecometheprovisional liquidator and shall continue to act as such until he or another person becomes liquidator and is capable of acting as such;

(b) theTrustee shall summon separate meetings of the creditors and contributories of the company for the purpose of determining whether or not an application is to be made to theCourtforappointingaliquidator intheplaceof theTrustee;

(c) the Court may make any appointment and order required to give effect to any such determination, and, if there is a difference between the determinations of the meetings of the creditors and contributories in respect of the matter aforesaid, the Court shall decide the difference and make such order thereon as the Court may think fit;

(d) in a case where a liquidator is not appointed by the Court, the Trustee shall be the liquidator of the company;

(e) the Trustee shall by virtue of his office be the liquidator during any vacancy;

(f) a liquidator shall be described, where a person other than theTrustee is liquidator, by the style of "the liquidator", and,

Power of Court to appoint liquidators.

Appointment and powers of provisional liquidator.

Appointment style, etc. of liquidators.

[No. ] The Companies Act, 2004188

where the Trustee is liquidator, by the style of “the Trustee andliquidator”,of theparticularcompanyinrespectof which he is appointed, and not by his individual name.

(2) The Trustee may charge such fees as may be prescribed by the Minister for duties carried out by him as provisional liquidator.

237.—(1) Where in the winding up of a company by the Court a person other than the Trustee is appointed liquidator, that person—

(a) shallnotbecapableofactingas liquidatoruntilhehasnotified his appointment to the Registrar and given security in such manner as the Court may direct;

(b) shall give the Trustee such information and such access to and facilities for inspecting the books and documents of the company and generally such aid as may be requisite for enabling that officer to perform his duties under thisAct.

(2) If a liquidator contravenes the provisions of paragraph (b) of subsection (1), he shall be liable to a fine not exceeding fifty thousand dollars.

238.—(1) A liquidator appointed by the Court may resign or, on cause shown, be removed by the Court.

(2) Where a person other than the Trustee is appointed liquidator, he shall receive such salary or remuneration by way of percentage or otherwise as the Court may direct, and, if more than one such person are appointed liquidators, their remuneration shall be distributed among them in such proportions as the Court directs.

(3) Avacancy in the office of a liquidator appointed by the Court shall be filled by the Court.

(4) If more than one liquidator is appointed by the Court, theCourt shalldeclarewhetheranyactby thisAct requiredorauthorized to be done by the liquidator is to be done by all or any one or more of the persons appointed.

Provisions where person other than Trustee is appointed liquidator.

General provisions as to liquidators.

189The Companies Act, 2004 [No. ]

(5) Subject to the provisions of section 325, the acts of a liquidator shallbevalidnotwithstandinganydefects thatmayafterwards be discovered in his appointment or qualification.

239.Whereawindinguporderhasbeenmadeorwhereaprovisional liquidatorhasbeenappointed, the liquidator,or theprovisional liquidator, as the case may be, shall take into his custody, or under his control, all the property and things in action to which the company is or appears to be entitled.

240. Where a company is being wound up by the Court, the Court may on the application of the liquidator by order direct that all or any part of the property of whatever description belonging to the company or held by trustees on its behalf shall vest in the liquidator by his official name, and thereupon the property to which the order relates shall vest accordingly, and the liquidator may, after giving such indemnity, if any, as the Court may direct, bring or defend in his official name any action or other legal proceeding which relates to that property or which it is necessary to bring or defend for the purpose of effectually winding up the company and recovering its property.

241.—(1) The liquidator in a winding up by the Court shall have power with the sanction either of the Court or of the committee of inspection—

(a) to bring or defend any action or other legal proceeding in the name and on behalf of the company;

(b) to carry on the business of the company, so far as may be, necessary for the beneficial winding up thereof;

(c) to appoint an attorney-at-law or other agent to assist him in the performance of his duties;

(d) to pay any classes of creditors in full;

(e) to make any compromise or arrangement with creditors or persons claiming to be creditors, or having or alleging themselves to have any claim, present or future, certain or contingent, ascertained or sounding only in damages against the company, or whereby the company may be rendered liable;

Custody of company's property.

Vesting of company's property in liquidator.

Powers of liquidator.

[No. ] The Companies Act, 2004190

(f) to compromise all calls and liabilities to calls, debts, and liabilitiescapableof resulting indebts, andall claims,present or future, certain or contingent, ascertained or sounding only in damages, subsisting or supposed to subsist between the companyandacontributory,orallegedcontributory,orother debtor or person apprehending liability to the company, and all questions in any way relating to or affecting the assets or the winding up of the company, on such terms as may be agreed, and take any security for the discharge of any such debt, liability or claim, and give a complete discharge in respect thereof.

(2) The liquidator in a winding up by the Court shall have power—

(a) to sell the real and personal property and things in action of the company by public auction or private contract, with power to transfer the whole thereof to any person or company, or to sell the same in parcels;

(b) to do all acts and to execute, in the name and on behalf of the company, all deeds, receipts, and other documents, and for that purpose to use, when necessary, the company’s seal;

(c) to prove, rank, and claim in the bankruptcy, insolvency, or sequestration of any contributory, for any balance against his estate, and to receive dividends in the bankruptcy, insolvency, or sequestration in respect of that balance, as a separatedebtduefromthebankruptor insolvent,andrateably with the other separate creditors;

(d) to draw, accept, make, and indorse any bill of exchange or promissory note in the name and on behalf of the company, with the same effect with respect to the liability of the company as if the bill or note had been drawn, accepted, made, or indorsed by or on behalf of the company in the course of its business;

(e) to raise on the security of the assets of the company any moneyrequisite;

191The Companies Act, 2004 [No. ]

(f) to takeout inhisofficialname lettersofadministration toany deceased contributory, and to do in his official name any other act necessary for obtaining payment of any money due fromacontributoryorhisestatewhichcannotbeconveniently done in the name of the company, and in all such cases the money due shall, for the purpose of enabling the liquidator to take out the letters of administration or recover the money, be deemed to be due to the liquidator himself;

(g) to appoint an agent to do any business which the liquidator is unable to do himself;

(h) to do all such other things as may be necessary for winding up the affairs of the company and distributing its assets.

(3) The exercise by the liquidator in a winding up by the Court of the powers conferred by this section shall be subject to the control of the Court, and any creditor or contributory may apply to the Court with respect to any exercise or proposed exercise of any of those powers.

242.—(1) Subject to the provisions of thisAct, the liquidator of a company which is being wound up by the Court shall, in the administrationof theassetsof thecompanyandin thedistribution thereof among its creditors, have regard to any directions that may be given by resolution of the creditors or contributories, at any general meeting, or by thecommitteeof inspection,andanydirectionsgivenby thecreditors or contributories at any general meeting shall in case of conflict be deemedtooverrideanydirectionsgivenby thecommitteeof inspection.

(2) The liquidator may summon general meetings of the creditors or contributories for the purpose of ascertaining their wishes, and it shallbehisduty tosummonmeetingsat such timesas thecreditors or contributories, by resolution, either at the meeting appointing the liquidator or otherwise, may direct, or whenever requested in writing to do so by one-tenth in value of the creditors or contributories as the case may be.

(3) The liquidator may apply to the Court in manner prescribedfordirections in relation toanyparticularmatterarisingunder the winding up.

Exercise and control of liquidator's powers.

[No. ] The Companies Act, 2004192

(4) Subject to the provisions of thisAct, the liquidator shall usehisowndiscretioninthemanagementof theestateanditsdistribution among the creditors.

(5) Any person aggrieved by any act or decision of the liquidator, may apply to the Court, and the Court may confirm, reverse, or modify the act or decision complained of, and make such order in the premises as it thinks just.

243.—(1) Every liquidator of a company which is being wound up by the Court shall keep, in the prescribed manner, proper books in which he shall cause to be made entries or minutes of proceedings at meetings, and of such other matters as may be prescribed, and any creditor or contributory may, subject to the control of the Court, personally or by his agent inspect any such books.

(2) If a liquidator fails to keep proper books as required by subsection (1) or refuses to allow any inspection permitted thereby, he shall be liable to a fine not exceeding fifty thousand dollars.

244.—(1) Every liquidator of a company which is being wound up by the Court shall pay the money received by him into such bank as the Court may direct.

(2) If any such liquidator at any time retains for more than ten days a sum exceeding one hundred thousand dollars, or such other amount as the Court in any particular case authorizes him to retain, then, unless he explains the retention to the satisfaction of the Court, he shall pay interest on the amount so retained in excess at the rate of twenty per centum per annum, and shall be liable to disallowance of all or such part of his remuneration as the Court may think just, and to be removed from his office by the Court, and shall be liable to pay any expenses occasioned by reason of his default.

(3) Aliquidator of a company which is being wound up by the Court shall not pay any sums received by him as liquidator into his private banking account.

(4) If a liquidator contravenes the provisions of subsection (3), he shall be liable to a fine not exceeding fifty thousand dollars.

Books to be kept by liquidator.

Payments of liquidator into bank.

193The Companies Act, 2004 [No. ]

245.—(1) Every liquidator of a company which is being wound up by the Court shall, at such times as may be prescribed but not less than twice in each year during his tenure of office, send to the Registrar an account of his receipts and payments as liquidator.

(2) The account shall be in a prescribed form, shall be made induplicate,andshallbeverifiedbyanaffidavitorastatutorydeclaration in the prescribed form.

(3) The Registrar shall cause the account to be audited and for the purpose of the audit the liquidator shall furnish the Registrar with such vouchers and information as the Registrar may require, and the Registrar may at any time require the production of and inspect any books or accounts kept by the liquidator.

(4) When the account has been audited, one copy thereof shall be filed and kept by the Registrar, and the other copy shall be delivered to the Court for filing, and each copy shall be open to the inspection of any creditor or of any person interested.

(5) The Registrar shall cause the account when audited or a summary thereof to be printed, and shall send a printed copy of the account or summary by post to every creditor and contributory.

(6) If a liquidator fails to comply with any of the duties imposed upon him by this section, he shall be liable to a fine not exceeding fifty thousand dollars.

246.—(1) The Registrar shall take cognizance of the conduct of liquidators of companies which are being wound up by the Court, and, if a liquidator does not faithfully perform his duties and duly observe all the requirements imposed on him by statute, rules, or otherwise with respect to the performance of his duties, or if any complaint is made to the Registrar by any creditor or contributory in regard thereto, the Registrar shall inquire into the matter, and take such action thereon as he may think expedient.

(2) The Registrar may at any time require any liquidator of a company which is being wound up by the Court to answer any inquiry in relation to any winding up in which he is engaged, and may if the

Audit of liquidator's accounts.

Control of Registrar over liquidators.

[No. ] The Companies Act, 2004194

Registrar thinks fit, apply to the Court to examine him or any other person on oath concerning the winding up.

(3) The Registrar may also direct an investigation to be made of the books and vouchers of the liquidator.

247.—(1) When the liquidator of a company which is being wound up by the Court has realized all the property of the company, or so much thereof as can, in his opinion, be realized without needlessly protracting the liquidation, and has distributed a final dividend, if any, to the creditors, and adjusted the rights of the contributories among themselves, and made a final return, if any, to the contributories, or has resigned, or has been removed from his office, the Registrar shall, on his application, cause a report on his accounts to be prepared, and, on his complying with all the requirements of the Registrar, shall take into consideration the report, and any objection which may be urged by any creditor or contributory or person interested against the release of the liquidator, and shall either grant or withhold the release accordingly, subject nevertheless to an appeal to the Court.

(2) Where the release of a liquidator is withheld, the Court may, on the application of any creditor or contributory, or person interested, make such order as it thinks just, charging the liquidator with the consequences of any act or default which he may have done or made contrary to his duty.

(3) An order of the Registrar releasing the liquidator shall discharge him from all liability in respect of any act done or default made by him in the administration of the affairs of the company, or otherwise in relation to his conduct as liquidator, but any such order maybe revokedonproof that itwasobtainedby fraudorbysuppression or concealment of any material fact.

(4) Where the liquidator has not previously resigned or been removed, his release shall operate as a removal of him from his office.

Release of liquidator.

195The Companies Act, 2004 [No. ]

Committees of Inspection

248.—(1) When a winding up order has been made by the Court, it shall be the business of the separate meetings of creditors and contributories summoned for the purpose of determining whether or notanapplicationshouldbemadeto theCourt forappointinga liquidator inplaceof theTrustee, todeterminefurtherwhetherornotanapplication is to be made to the Court for the appointment of a committee of inspection to act with the liquidator and who are to be members of the committee if appointed.

(2) TheCourtmaymakeanyappointmentandorder required to give effect to any such determination, and if there is a difference between the determinations of the meetings of the creditors and contributories in respect of the matters aforesaid the Court shall decide the difference and make such order thereon as the Court may think fit.

249.—(1)Acommittee of inspection appointed in pursuance of this Act shall consist of creditors and contributories of the company or persons holding general powers of attorney from creditors or contributories in such proportions as may be agreed on by the meetings of creditors and contributories, or as, in case of difference, may be determined by the Court.

(2) The committee shall meet at such times as they from time to time appoint, and, failing such appointment, at least once a month and the liquidator or any member of the committee may also call a meeting of the committee as and when he thinks necessary.

(3) The committee may act by a majority of their members present at ameeting,but shall not actunlessamajorityof thecommittee are present.

(4) A member of the committee may resign by notice in writing signed by him and delivered to the liquidator.

(5) If a member of the committee becomes bankrupt, or compounds or arranges with his creditors, or is absent from five consecutive meetings of the committee without the leave of those members who together with himself represent the creditors or contributories, as the case may be, his office shall thereupon become vacant.

(6) A member of the committee may be removed by an ordinary resolution at a meeting of creditors, if he represents creditors,

Meetings of creditors and contributories to determine whether committee of inspection shall be appointed.

Constitution and proceed- ings of committee of inspection.

[No. ] The Companies Act, 2004196

or of contributories, if he represents contributories of which seven days’ notice has been given, stating the object of the meeting.

(7) On a vacancy occurring in the committee the liquidator shall forthwith summon a meeting of creditors or of contributories, as the case may require, to fill the vacancy, and the meeting may, by resolution, reappoint thesameorappointanothercreditororcontributory to fill the vacancy:

Provided that if the liquidator, having regard to the position in the winding up, is of the opinion that it is unnecessary for the vacancy to be filled he may apply to the Court which may make an order that the vacancy shall not be filled, or shall not be filled except in such circumstances as may be specified in the order.

(8) The continuing members of the committee, if not less than two, may act notwithstanding any vacancy in the committee.

250. Where in the case of a winding up there is no committee of inspection, the Minister may, on the application of the liquidator, do any act or thing or give any direction or permission which is by thisAct authorized or required to be done or given by the committee.

General Powers of Court in case of Winding up by Court

251.—(1) The Court may at any time after an order for winding up, on the application either of the liquidator, or theTrustee, or any creditor or contributory, and on proof to the satisfaction of the Court that all proceedings in relation to the winding up ought to be stayed, make an order staying the proceedings, either altogether or for a limited time on such terms and conditions as the Court thinks fit.

(2) On any application under this section the Court may, before making an order, require the Trustee to furnish to the Court a report with respect to any facts or matters which are in his opinion relevant to the application.

(3) A copy of every order made under this section shall forthwith be forwarded by the company, or otherwise as may be prescribed, to the Registrar, who shall make a minute of the order in his books relating to the company.

Powers of Minister where no committee of inspection.

Power to stay winding up.

197The Companies Act, 2004 [No. ]

252.—(1)As soon as may be after making a winding up order, the Court shall settle a list of contributories, with power to rectify the register of members in all cases where rectification is required in pursuance of thisAct, and shall cause the assets of the company to be collected, and applied in discharge of its liabilities:

Provided that, where it appears to the Court that it will not be necessary to make calls on or adjust the rights of contributories, the Court may dispense with the settlement of a list of contributories.

(2) In settling the list of contributories, the Court shall distinguish between persons who are contributories in their own right and persons who are contributories as being representatives of or liable for the debts of others.

253. The Court may, at any time after making a winding up order, require any contributory for the time being on the list of contributors, and any trustee, receiver, banker, agent or officer of the company to pay, deliver, convey, surrender, or transfer forthwith, or within such time as the Court directs, to the liquidator any money, property, or books and papers in his hands to which the company is prima facie entitled.

254.—(1) The Court may, at any time after making a winding up order, make an order on any contributory for the time being on the list of contributories to pay, in manner directed by the order, any money due from him or from the estate of the person whom he represents to the company, exclusive of any money payable by him or the estate by virtue of any call in pursuance of thisAct.

(2) The Court in making such an order may, in the case of an unlimited company, allow to the contributory by way of set-off any money due to him or the estate which he represents from the company on any independent dealing or contract with the company, but not any moneyduetohimasamemberof thecompanyinrespectofanydividend or profit.

(3) In thecaseofanycompany,whether limitedorunlimited, when all the creditors are paid in full, any money due on any account whatever to a contributory from the company may be allowed to him by way of set-off against any subsequent call.

Settlement of list of contributories and application of assets.

Delivery of property to liquidator.

Payment of debts due by contributory to company and extent to which set-off allowed.

[No. ] The Companies Act, 2004198

255.—(1) The Court may, at any time after making a winding up order, and either before or after it has ascertained the sufficiency of the assets of the company, make calls on all or any of the contributories for the time being settled on the list of the contributories to the extent of their liability, for payment of any money which the Court considers necessary to satisfy the debts and liabilities of the company, and the costs, charges, and expenses of winding up, and for the adjustment of the rights of the contributories, among themselves, and make an order for payment of any calls so made.

(2) On making a call the Court may take into consideration the probability that some of the contributories may partly or wholly fail to pay the call.

256.—(1)The Court may order any contributory, purchaser or other person from whom money is due to the company to pay the amount due into a bank to the account of the liquidator instead of to the liquidator, and any such order may be enforced in the same manner as if it had directed payment to the liquidator.

(2) All moneys and securities paid or delivered into such bank in the event of a winding up by the Court shall be subject in all respects to the orders of the Court.

257.—(1)Anordermadeby theCourtonacontributoryshall, subject to any right of appeal, be conclusive evidence that the money, if any, thereby appearing to be due or ordered to be paid is due.

(2) All other pertinent matters stated in the order shall be taken to be truly stated as against all persons and in all proceedings.

258.—(1) Where in any proceedings the Trustee becomes the liquidator of a company, whether provisionally or otherwise, he may, if satisfied that the nature of the estate or business of the company, or the interests of the creditors or contributories generally, require the appointment of a special manager of the estate or business of the company other than himself, apply to the Court, and the Court may on such application appoint a special manager of that estate or business to actduringsuchtimeas theCourtmaydirect,withsuchpowers, including any of the powers of a receiver or manager, as may be entrusted to him by the Court.

Power of Court to make calls.

Payment into bank of moneys due to company.

Order on contributory conclusive evidence.

Appointment of special manager.

199The Companies Act, 2004 [No. ]

(2) Thespecialmanager shallgivesuchsecurityandaccount in such manner as the Court directs.

(3) The special manager shall receive such remuneration as may be fixed by the Court.

259. The Court may fix a time or times within which creditors are to prove their debts or claims or to be excluded from the benefit of any distribution made before those debts are proved.

260. The Court shall adjust the rights of the contributories among themselves,anddistributeanysurplusamongthepersonsentitledthereto.

261.—(1) The Court may, at any time after making a winding up order, make such order for inspection of the books and papers of the company by creditors and contributories as the Court thinks just, and anybooksandpapers in thepossessionof thecompanymaybeinspected by creditors or contributories accordingly, but not further or otherwise.

(2) Nothing in this section shall be taken as excluding or restricting any statutory rights of a Government Department or person acting under the authority of a Government Department.

262. The Court may, in the event of the assets being insufficient to satisfy the liabilities, make an order as to the payment out of the assets of the costs, charges and expenses incurred in the winding up in such order of priority as the Court thinks just.

263.—(1) The Court may, at any time after the appointment of a provisional liquidator or the making of a winding up order, summon before it any officer of the company or person known or suspected to have in his possession any property of the company, or supposed to be indebted to the company, or any person whom the Court deems capable of giving information concerning the promotion, formation, trade, dealings, affairs, or property of the company.

(2) The Court may examine him on oath concerning the matters aforesaid, either by word of mouth or on written interrogatories, and may reduce his answers to writing and require him to sign them.

(3) The Court may require him to produce any books and papers in his custody or power relating to the company, but, where he

Power to exclude creditors not proving in time.

Adjustment of rights of contributories.

Inspection of books by creditors and contributories.

Power to order costs of winding up to be paid out of assets.

Power to summon persons suspected of having company property.

[No. ] The Companies Act, 2004200

claims any lien on books or papers produced by him, the production shallbewithoutprejudicetothat lien,andtheCourtshallhavejurisdiction in the winding up to determine all questions relating to that lien.

(4) If any person so summoned, after being tendered a reasonable sum for his expenses, refuses to come before the Court at the time appointed, not having a lawful impediment (made known to the Court at the time of its sitting, and allowed by it), the Court may cause him to be apprehended and brought before the Court for examination.

264. Where an order has been made for winding up a company by the Court, and the Trustee has made a further report under this Act stating that in his opinion a fraud has been committed by any person in the promotion or formation of the company, or by any director or other officer of the company in relation to the company since its formation, the Court may, after consideration of the report, direct that the person, director or officer shall attend before the Court on a day appointed by theCourt for thatpurpose, andbepubliclyexaminedas to thepromotion or formation or the conduct of the business of the company, or as to his conduct and dealings as director or officer thereof.

265.—(1) The Trustee shall take part in the examination, and for that purpose may, if specially authorized by the Court in that behalf, employ an attorney-at-law.

(2) The liquidator, where the Trustee is not the liquidator, and any creditor or contributory, may also take part in the examination either personally or by an attorney-at-law.

(3) TheCourtmayputsuchquestions to thepersonexamined as the Court thinks fit.

(4) The person examined shall be examined on oath, and shall answer all such questions as the Court may put or allow to be put tohim.

(5) Aperson ordered to be examined shall at his own cost, beforehisexamination,be furnishedwithacopyof theTrustee’s report, and may at his own cost employ an attorney-at-law, who shall be at

Power to order public examination of promoters, directors, etc.

Procedure at examination.

201The Companies Act, 2004 [No. ]

liberty to put to him such questions as the Court may deem just for the purposeofenablinghimtoexplainorqualifyanyanswersgivenbyhim:

Provided that, if anysuchpersonapplies to theCourt tobeexculpated from any charges made or suggested against him, it shall be the duty of the Trustee to appear on the hearing of the application and call the attention of the Court to any matters which appear to the Trustee to be relevant, and if the Court, after hearing any evidence given or witnesses called by the Trustee, grants the application, the Court may allow the applicant such costs as in its discretion it may think fit.

(6) Notes of the examination shall be taken down in writing, and shall be read over to or by, and signed by, the person examined, and may thereafter be used in evidence against him, and shall be open to the inspection of any creditor or contributory at all reasonable times.

(7) The Court may, if it thinks fit, adjourn the examination from time to time.

266. The Court, at any time either before or after making a winding up order, on proof of probable cause for believing that a contributory is about to quit the Island or otherwise to abscond or to remove or conceal any of his property for the purpose of evading payment of calls, or of avoiding examination respecting the affairs of the company, may cause the contributory to be arrested, and his books and papers and movable personal property to be seized, and him and them to be safely kept until such time as the Court may order.

267. Any powers by this Act conferred on the Court shall be in addition to and not in restriction of any existing powers of instituting proceedings against any contributory or debtor of the company, or the estate of any contributory or debtor, for the recovery of any call or other sums.

268. Provision may be made by rules for enabling or requiring all or any of the powers and duties conferred and imposed on the Court by thisAct in respect of the following matters—

(a) theholdingandconductingofmeetingstoascertainthewishes of creditors and contributories;

Power to arrest absconding contributory.

Powers of Court cumulative.

Delegation to liquidator of certain powers of court.

[No. ] The Companies Act, 2004202

(b) the settling of lists of contributories and the rectifying of the register of members where required, and the collecting and applying of the assets;

(c) the paying, delivering, conveyance, surrender or transfer of money, property, books or papers to the liquidator;

(d) the making of calls;

(e) the fixing of a time within which debts and claims must be proved, to be exercised or performed by the liquidator as an officer of the Court, and subject to the control of the Court:

Provided that the liquidator shall not, without the special leave of the Court, rectify the register of members, and shall not make any call without either the special leave of the Court or the sanction of the committee of inspection.

269.—(1) When the affairs of a company have been completely wound up, the Court, if the liquidator makes an application in that behalf, shall make an order that the company be dissolved from the date of the order, and the company shall be dissolved accordingly.

(2) Theorder shallwithin fourteendays fromthedate thereof be forwarded by the liquidator to the Registrar who shall make in his books a minute of the dissolution of the company.

(3) If the liquidator makes default in complying with the requirements of this section, he shall be liable to a fine not exceeding two thousand dollars for every day during which he is in default.

Enforcement of, and appeal from, orders

270. Orders made by the Court under thisAct may be enforced in the same manner as orders made in any action pending therein.

271. Subject to rules of court, an appeal from any order or decision made or given in the winding up of a company by the Court under this Act shall lie in the same manner and subject to the same conditions as an appeal from any order or decision of the Court.

Dissolution of company.

Power to enforce orders.

Appeal from orders.

203The Companies Act, 2004 [No. ]

(iii) VOLUNTARYWINDING UP

Resolutions for, and Commencement of, Voluntary Winding Up

272.—(1)Acompany may be wound up voluntarily—

(a) when theperiod, if any, fixed for thedurationof thecompany by the articles expires, or the event, if any, occurs, on the occurrence of which the articles provide that the company is to be dissolved, and the company in general meeting has passed a resolution requiring the company to be wound up voluntarily;

(b) if the company resolves by special resolution that the company be wound up voluntarily;

(c) if the company resolves by extraordinary resolution to the effect that it cannot by reason of its liabilities continue its business, and that it is advisable to wind up.

(2) In this Act the expression “a resolution for voluntary winding up” means a resolution passed under any of the provisions of subsection (1).

273.—(1) When a company has passed a resolution for voluntary winding up, it shall, within fourteen days after the passing of the resolution, give notice of the resolution by advertisement in the Gazette and in writing to the Registrar.

(2) If default is made in complying with this section, the company and every officer of the company who is in default shall be liable to a default fine not exceeding one hundred thousand dollars, and for the purposes of this subsection the liquidator of the company shall be deemed to be an officer of the company.

274. Avoluntary winding up shall be deemed to commence at the time of the passing of the resolution for voluntary winding up.

Consequences of Voluntary Winding Up

275. In case of a voluntary winding up, the company shall, from the commencementof thewindingup, cease tocarryon itsbusiness, except so far as may be required for the beneficial winding up thereof:

Provided that the corporate state and corporate powers of the company shall, notwithstanding anything to the contrary in its articles, continue until it is dissolved.

Circumstances in which company may be wound up voluntarily.

Notice of resolution to wind up voluntarily.

Commence- ment of voluntary winding up.

Effect of voluntary winding up on business and status of company.

[No. ] The Companies Act, 2004204

276. Any transfer of shares not being a transfer made to or with the sanctionof the liquidator, andanyalteration in thestatusof themembers of the company, made after the commencement of a voluntary winding up, shall be void.

Declaration of Solvency

277.—(1) Where it is proposed to wind up a company voluntarily, the directors of the company or, in the case of a company having more than two directors, the majority of the directors, may, at a meeting of the directors make a statutory declaration to the effect that they have made a full inquiry into the affairs of the company, and that, having so done, they have formed the opinion that the company will be able to pay its debts in full within such period not exceeding twelve months from the commencement of the winding up as may be specified in the declaration.

(2) Adeclaration made as aforesaid shall have no effect for the purposes of thisAct unless—

(a) it is made within the five weeks immediately preceding the date of the passing of the resolution for winding up the company and is delivered to the Registrar for registration before that date; and

(b) it embodiesastatementof thecompany’sassetsand liabilities as at the latest practicable date before the making of the declaration.

(3) Any director of a company making a declaration under this section without having reasonable grounds for the opinion that the company will be able to pay its debts in full within the period specified in the declaration, shall be liable to imprisonment with or without hard labour for a period not exceeding six months or to a fine not exceeding fifty thousand dollars or to both such imprisonment and fine; and if the company is wound up in pursuance of a resolution passed within the period of five weeks after the making of the declaration, but its debts

Avoidance of transfers, etc., after commence- ment of voluntary winding up.

Statutory declaration of solvency in case of proposal to wind up voluntarily.

205The Companies Act, 2004 [No. ]

are not paid or provided for in full within the period stated in the declaration, it shall be presumed until the contrary is shown that the director did not have reasonable grounds for his opinion.

(4) Awinding up in the case of which a declaration has been madeanddelivered inaccordancewith this section is in thisAct referred to as “a members’ voluntary winding up”, and a winding up in the case of which a declaration has not been made and delivered as aforesaid is in thisAct referred to as “a creditors’voluntary winding up”.

Provisions applicable to a Members’Voluntary Winding Up

278. The provisions contained in sections 280 to 286 (inclusive) shall apply in relation to a members’ voluntary winding up.

279.—(1)Thecompany ingeneralmeetingshall appointoneormore liquidators for the purpose of winding up the affairs and distributing the assets of the company, and may fix the remuneration to be paid to him or them.

(2) On the appointment of a liquidator all the powers of the directors shall cease, except so far as the company in general meeting, or the liquidator, sanctions the continuance thereof.

280.—(1) If a vacancy occurs by death, resignation, or otherwise in the office of liquidator appointed by the company, the company in general meeting may, subject to any arrangement with its creditors, fill the vacancy.

(2) For that purpose a general meeting may be convened by any contributory or, if there were more than one liquidator, by the continuingliquidators.

(3) The meeting shall be held in manner provided by this Act or by the articles, or in such manner as may, on application by any contributory or by the continuing liquidators, be determined by the Court.

Provisions applicable to members' winding up.

Power of company to appoint and fix remunera- tion of liquidators.

Power to fill vacancy in office of liquidator.

[No. ] The Companies Act, 2004206

281.—(1) Where a company is proposed to be, or is in the course of being wound up altogether voluntarily, and the whole or part of its business or property is proposed to be transferred or sold to another company, whether a company within the meaning of thisAct or not (in this section called “the transferee company”) the liquidator of the firstmentionedcompany(in thissectioncalled“the transferorcompany”) may—

(a) with the sanction of a special resolution of that company, conferring either a general authority on the liquidator or an authority in respect of any particular arrangement, receive, in compensation or part compensation for the transfer or sale, shares, policies, or other like interests in the transferee company, for distribution among the members of the transferor company; or

(b) enter into any other arrangement whereby the members of the transferorcompanymay, in lieuof receivingcash, shares, policies, or other like interests, or in addition thereto, participate in the profits of or receive any other benefit from the transferee company.

(2) Any sale or arrangement in pursuance of this section shall be binding on the members of the transferor company, and where thewholeorpartof thecompensationorbenefit accruing to themembers of the transferor company in respect of any such sale or arrangement consists of fully paid shares in the transferee company each such member shall be deemed to have agreed with the transferee company for the acceptance of the fully paid shares to which he is entitled under the distribution referred to in subsection (1).

(3) If any member of the transferor company who did not vote in favour of the special resolution express his dissent therefrom in writing addressed to the liquidator, and left at the registered office of the company within seven days after the passing of the resolution, he may require the liquidator either to abstain from carrying the resolution into effect, or to purchase his interest at a price to be determined by agreement or by arbitration in manner provided by theArbitrationAct.

Power of liquidator to accept shares etc., as consideration for sale of property of company.

207The Companies Act, 2004 [No. ]

(4) If the liquidator elects to purchase the member’s interest, the purchase money shall be paid before the company is dissolved, and be raised by the liquidator in such manner as may be determined by special resolution.

(5) Aspecial resolution shall not be invalid for the purposes of this section by reason that it is passed before or concurrently with a resolution for voluntary winding up or for appointing liquidators, but, if anorder ismadewithinayear forwindingup thecompanybyor subject to the supervision of the Court, the special resolution shall not be valid unless sanctioned by the Court.

282.—(1) If, in the case of a winding up commenced after the appointed day, the liquidator is at any time of opinion that the company will not be able to pay its debts in full within the period stated in the declaration under section 277, he shall forthwith summon a meeting of the creditors, and shall lay before the meeting a statement of the assets and liabilities of the company.

(2) If the liquidator fails to comply with this section, he shall be liable toafinenotexceedingfifty thousanddollarsor to imprisonment foratermnotexceedingsixmonthsortobothsuchfineandimprisonment.

283.—(1) Subject to the provisions of section 286, in the event of the winding up continuing for more than one year, the liquidator shall summon a general meeting of the company at the end of the first year from the commencement of the winding up and of each succeeding year, or at the first convenient date within three months (or such longer period as the Minister may allow) from the end of the year, and shall lay before the meeting an account of his acts and dealings and of the conduct of the winding up during the preceding year.

(2) If the liquidator fails to comply with this section, he shall be liable to a fine not exceeding fifty thousand dollars.

284.—(1) Subject to the provisions of section 285, as soon as the affairs of the company are fully wound up, the liquidator shall make up an account of the winding up, showing how the winding up has been conducted and the property of the company has been disposed of, and

Duty of liquidator to call creditors' meeting in case of insolvency.

Duty of liquidator to call general meeting at end of each year.

Final meeting and dissolution.

[No. ] The Companies Act, 2004208

thereupon shall call a general meeting of the company for the purpose of laying before it the account, and giving any explanation thereof.

(2) The meeting shall be called by advertisement in the Gazette and in one daily newspaper printed and circulating in the Island, specifying the time, place, and object thereof, and published one month at least before the meeting.

(3) Within one week after the meeting, the liquidator shall send to the Registrar a copy of the account, and shall make a return to him of the holding of the meeting and of its date, and if the copy is not sent or the return is not made in accordance with this subsection the liquidator shall be liable to a fine not exceeding two thousand dollars for every day during which the default continues:

Provided that, if a quorum is not present at the meeting, the liquidator shall, in lieu of the return as aforesaid, make a return that the meeting was duly summoned and that no quorum was present thereat, and upon such a return being made the provisions of this subsection as to the making of the return shall be deemed to have been complied with.

(4) The Registrar on receiving the account and either of the returnshereinbeforementionedshall forthwith register them, andon the expirationofthreemonthsfromtheregistrationofthereturn, thecompany shall be deemed to be dissolved:

Provided that the Court may, on the application of the liquidator or of any other person who appears to the Court to be interested, make an order deferring the date at which the dissolution of the company is to take effect for such time as the Court thinks fit.

(5) It shall be the duty of the person on whose application an order of the Court under this section is made, within seven days after the making of the order, to deliver to the Registrar a copy of the order for registration, and if that person fails so to do he shall be liable to a fine not exceeding two thousand dollars for every day during which the default continues.

(6) If the liquidator fails to call a general meeting of the company as required by this section, he shall be liable to a fine not exceeding fifty thousand dollars.

209The Companies Act, 2004 [No. ]

285. Where section 282 has effect, sections 293 and 294 shall apply to the winding up to the exclusion of sections 283 and 284, as if the winding up were a creditors’ voluntary winding up and not a members' voluntarywindingup:

Providedthat the liquidatorshallnotberequired tosummonameeting of creditors under section 293 at the end of the first year from the commencementof thewindingup,unless themeetingheldundersection 282 is held more than three months before the end of that year.

Provisions applicable to a Creditors’ Voluntary Winding Up

286. The provisions contained in sections 287 to 294 (inclusive) shall apply in relation to a creditors’ voluntary winding up.

287.—(1) The company shall cause a meeting of the creditors of the company to be summoned for the day, or the day next following the day, on which there is to be held the meeting at which the resolution for voluntary winding up is to be proposed, and shall cause the notices of themeetingofcreditors tobesentbypost to thecreditors simultaneously with the sending of the notices of the meeting of the company.

(2) The company shall cause notice of the meeting of the creditors to be advertised once in the Gazette and once at least in one daily newspaper printed and circulating in the Island.

(3) The directors of the company shall—

(a) cause a full statement of the position of the company’s affairs together with a list of the creditors of the company and the estimated amount of their claims to be laid before the meeting of creditors to be held as aforesaid; and

(b) appoint one of their number to preside at that meeting.

(4) It shall be the duty of the director appointed to preside at the meeting of creditors to attend the meeting and preside thereat.

(5) If the meeting of the company at which the resolution for voluntary winding up is to be proposed is adjourned and the resolution

Alternative provisions as to annual and final meetings in case of insolvency.

Provisions applicable to creditor's winding up.

Meeting of creditors.

[No. ] The Companies Act, 2004210

is passed at an adjourned meeting, any resolution passed at the meeting of the creditors held in pursuance of subsection (1) shall have effect as if it had been passed immediately after the passing of the resolution for winding up the company.

(6) If default is made—

(a) by the company in complying with subsections (1) and (2);

(b) bythedirectorsof thecompanyincomplyingwithsubsection (3);

(c) byanydirectorof thecompanyincomplyingwithsubsection (4),

the company, directors or director, as the case may be, shall be liable to a fine not exceeding fifty thousand dollars, and, in the case of default by the company, every officer of the company who is in default shall be liable to the like penalty.

288. The creditors and the company at their respective meetings mentioned in section 287 may nominate a person to be liquidator for the purpose of winding up the affairs and distributing the assets of the company, and if the creditors and the company nominate different persons, the person nominated by the creditors shall be liquidator, and if no person is nominated by the creditors the person, if any, nominated by the company shall be liquidator:

Provided that in the case of different persons being nominated any director, member, or creditor of the company may, within seven days after the date on which the nomination was made by the creditors, apply to theCourt foranordereitherdirecting that thepersonnominated as liquidator by the company shall be liquidator instead of or jointly with the person nominated by the creditors, or appointing some other person to be liquidator instead of the person appointed by the creditors.

289.—(1) The creditors at the meeting to be held in pursuance of section 287 or at any subsequent meeting, may, if they think fit, appoint a committee of inspection consisting of not more than five persons, and if suchacommittee isappointed thecompanymay,eitherat themeeting at which the resolution for voluntary winding up is passed or at any time subsequently in general meeting, appoint such number of persons as

Appointment of liquidator.

Appoint- ment of committee of inspect- tion.

211The Companies Act, 2004 [No. ]

they think fit to act as members of the committee not exceeding five in number:

Provided that—

(a) the creditors may, if they think fit, resolve that all or any of the persons so appointed by the company ought not to be members of the committee of inspection; and

(b) if the creditors so resolve, the persons mentioned in the resolution shall not, unless the Court otherwise directs, be qualified to act as members of the committee; and

(c) onanyapplication to theCourtunder thisprovision theCourt may, if it thinks fit, appoint other persons to act as such members in place of the persons mentioned in the resolution.

(2) Subject to the provisions of this section and to rules, the provisionsofsection249(except subsection(1)) shall applywith respect to a committee of inspection appointed under this section as they apply with respect to a committee of inspection appointed in a winding up by the Court.

290.—(1) The committee of inspection, or if there is no such committee, the creditors, may fix the remuneration to be paid to the liquidator or liquidators.

(2) On the appointment of a liquidator, all the powers of the directors shall cease, except so far as the committee of inspection, or if there is no such committee, the creditors, sanction the continuance thereof.

291. If a vacancy occurs, by death, resignation or otherwise, in the office of a liquidator, other than a liquidator appointed by, or by the direction of, the Court, the creditors may fill the vacancy.

292. The provisions of section 281 shall apply in the case of a creditors’ voluntary winding up as in the case of a members’ voluntary windingup,with themodification that thepowersof the liquidatorunder that section shall not be exercised except with the sanction either of the Court or of the committee of inspection.

Fixing of liquidators' remuneration and cesser of directors' powers.

Power to fill vacancy in office of liquidator.

Application of section 281 to creditors' winding up.

[No. ] The Companies Act, 2004212

293.—(1) In the event of the winding up continuing for more than oneyear, the liquidator shall summonageneralmeetingof thecompany and a meeting of creditors at the end of the first year from the commencement of the winding up, and of each succeeding year, or at the first convenient date within three months (or such longer period as the Minister may allow) from the end of the year, and shall lay before the meetings, an account of his acts and dealings and of the conduct of the winding up during the preceding year.

(2) If the liquidator fails to comply with this section, he shall be liable to a fine not exceeding fifty thousand dollars.

294.—(1) As soon as the affairs of the company are fully wound up, the liquidator shall make up an account of the winding up, showing how the winding up has been conducted and the property of the companyhasbeendisposedof,andthereuponshallcallageneralmeeting of the company and a meeting of the creditors, for the purpose of laying the account before the meetings, and giving any explanation thereof.

(2) Each such meeting shall be called by advertisement in the Gazette and in one daily newspaper printed and circulating in the Island specifying the time, place, and object thereof, and published one month at least before the meeting.

(3) Within one week after the date of the meetings, or, if the meetingsarenotheldon thesamedate, after thedateof the latermeeting, the liquidator shall send to the Registrar a copy of the account, and shall make a return to him of the holding of the meetings and of their dates, and if the copy is not sent or the return is not made in accordance with this subsection the liquidator shall be liable to a fine not exceeding two hundred dollars for every day during which the default continues:

Provided that, if a quorum is not present at either such meeting, the liquidator shall, in lieu of the return hereinbefore mentioned, make a return that the meeting was duly summoned and that no quorum was present thereat, and upon such a return being made the provisions of this subsection as to the making of the return shall, in respect of that meeting, be deemed to have been complied with.

Duty of liquidator to call meetings of company and of creditors at end of each year.

Final meeting and dissolution.

213The Companies Act, 2004 [No. ]

(4) The Registrar on receiving the account and in respect of each such meeting either of the returns hereinbefore mentioned shall forthwith register them, and on the expiration of three months from the registration thereof the company shall be deemed to be dissolved:

Provided that the Court may, on the application of the liquidator or of any other person who appears to the Court to be interested, make an order deferring the date at which the dissolution of the company is to take effect for such time as the Court thinks fit.

(5) It shall be the duty of the person on whose application an order of the Court under this section is made, within seven days after the making of the order, to deliver to the Registrar a copy of the order for registration, and if that person fails so to do he shall be liable to a fine not exceeding two thousand dollars for every day during which the default continues.

(6) If the liquidator fails to call a general meeting of the company or a meeting of the creditors as required by this section, he shall be liable to a fine not exceeding fifty thousand dollars.

Provisions Applicable to every Voluntary Winding up

295. The provisions contained in sections 294 to 298 (inclusive) shall apply to every voluntary winding up whether a members’ or a creditors’ winding up.

296. Subject to the provisions of thisAct as to preferential payments, the property of a company shall, on its winding up, be applied in satisfaction of its liabilities pari passu, and, subject to such application, shall, unless the articles otherwise provide, be distributed among the members according to their rights and interests in the company.

297.—(1) The liquidator may—

(a) in the case of a members’ voluntary winding up, with the sanction of an extraordinary resolution of the company, and, in the case of a creditors’ voluntary winding up, with the sanction of either the Court or the committee of inspection, exercise any of the powers given by paragraphs (d), (e) and

Provision applicable to every voluntary winding up.

Distribution of company's property.

Power and duties of liquidator in voluntary winding up.

[No. ] The Companies Act, 2004214

(f) of subsection (1) of section 239 to a liquidator in a winding up by the Court;

(b) without sanction, exercise any of the other powers by this Act given to the liquidator in a winding up by the Court;

(c) exercise the power of the Court under thisAct of settling a list of contributories, and the list of contributories shall be prima facie evidence of the liability of the persons named therein to be contributories;

(d) exercise the power of the Court of making calls;

(e) summon general meetings of the company for the purpose of obtaining the sanction of the company by special or extraordinary resolution or for any other purpose he may thinkfit.

(2) The liquidator shall pay the debts of the company and shall adjust the rights of the contributories among themselves.

(3) Whenseveral liquidatorsareappointed, anypowergiven by thisAct may be exercised by such one or more of them as may be determined at the time of their appointment, or, in default of such determination, by any number not less than two.

298.—(1) If from any cause whatever there is no liquidator acting, the Court may appoint a liquidator.

(2) The Court may, on cause shown, remove a liquidator and appoint another liquidator.

299.—(1) The liquidator shall, within twenty-one days after his appointment, publish in the Gazetteand in one daily newspaper printed and circulating in the Island, and deliver to the Registrar for registration a notice of his appointment in the prescribed form.

(2) If the liquidator fails to comply with the requirements of this section he shall be liable to a fine not exceeding two thousand dollars for every day during which the default continues.

300.—(1) Any arrangement entered into between a company about to be, or in the course of being, wound up and its creditors shall, subject to the right of appeal under this section, be binding on the company if

Power of Court to appoint and remove liquidator in voluntary winding up.

Notice by liquidator of his appoint- ment.

Arrangement when binding on creditors.

215The Companies Act, 2004 [No. ]

sanctionedbyanextraordinaryresolution,andonthecreditors ifacceded to by three-fourths in number and value of the creditors.

(2) Any creditor or contributory may, within three weeks from the completion of the arrangement, appeal to the Court against it, and the Court may thereupon, as it thinks just, amend, vary, or confirm the arrangement.

301.—(1) The liquidator or any contributory or creditor may apply to the Court to determine any question arising in the winding up of a company, or to exercise as respects the enforcing of calls, or any other matter, all or any of the powers which the Court might exercise if the company were being wound up by the Court.

(2) The Court, if satisfied that the determination of the question or the required exercise of power will be just and beneficial, may accede wholly or partially to the application on such terms and conditionsas it thinksfit,ormaymakesuchotherorderontheapplication as it thinks just.

(3) Acopy of an order made by virtue of this section staying the proceedings in the winding up shall forthwith be forwarded by the company, or otherwise as may be prescribed, to the Registrar, who shall make a minute of the order in his books relating to the company.

302. Allcosts, chargesandexpensesproperly incurred in thewinding up, including the remuneration of the liquidator, shall be payable out of the assets of the company in priority to all other claims.

303. The winding up of a company shall not bar the right of any creditor or contributory to have it wound up by the Court, but in the case of an application by a contributory the Court must be satisfied that the rightsof thecontributorieswillbeprejudicedbyavoluntarywinding up.

(iv) WINDING UP SUBJECT TO SUPERVISION OF COURT

304. When a company has passed a resolution for voluntary winding up, the Court may make an order that the voluntary winding up shall continue but subject to such supervision of the Court, and with such

Power to apply to Court to have questions determined or powers exercised.

Costs of voluntary winding up.

Saving for rights of creditors and contributories.

Power to order winding up subject to supervision.

[No. ] The Companies Act, 2004216

liberty for creditors, contributories, or others to apply to the Court, and generally on such terms and conditions, as the Court thinks just.

305. Apetition for the continuance of a voluntary winding up subject to thesupervisionof theCourt shall, for thepurposeofgiving jurisdiction to the Court over actions, be deemed to be a petition for winding up by the Court.

306. Awinding up subject to the supervision of the Court shall, for the purposes of sections 225 and 226, be deemed to be a winding up by the Court.

307.—(1) Where an order is made for a winding up subject to supervision, the Court may by that or any subsequent order appoint an additional liquidator.

(2) Aliquidator appointed by the Court under this section shall have the same powers, be subject to the same obligations, and in all respects stand in the same position, as if he had been duly appointed in accordance with the provisions of this Act with respect to the appointment of liquidators in a voluntary winding up.

(3) The Court may remove any liquidator so appointed by the Court or any liquidator continued under the supervision order and fill any vacancy occasioned by the removal, or by death or resignation.

308.—(1) Where an order is made for a winding up subject to supervision, the liquidator may, subject to any restrictions imposed by the Court, exercise all his powers, without the sanction or intervention of the Court, in the same manner as if the company were being wound upaltogethervoluntarily:

Provided that the powers specified in paragraphs (d), (e) and (f) of subsection (1) of section 241 shall not be exercised by the liquidator except with the sanction of the Court or, in a case where before the order the winding up was a creditors’ voluntary winding up, with the sanction of either the Court or the committee of inspection or (if there is no such committee) a meeting of the creditors.

(2) Awinding up subject to the supervision of the Court is not a winding up by the Court for the purpose of the provisions of this Act which are set out in the Sixth Schedule, but, subject as aforesaid, an order for a winding up subject to supervision shall for all purposes

Effect of petition for winding up subject to supervision.

Application of sections 225 and 226 to winding up subject to supervision.

Power of Court to appoint or remove liquidators.

Effect of supervision order.

Sixth Schedule.

217The Companies Act, 2004 [No. ]

be deemed to be an order for winding up by the Court:

Provided that where the order for winding up subject to supervision was made in relation to a creditors’ voluntary winding up in which a committee of inspection had been appointed, the order shall be deemed to be an order for winding up by the Court for the purpose of section 249 (except subsection (1) thereof) except in so far as the operation of that section is excluded in a voluntary winding up by rules.

(v) PROVISIONSAPPLICABLETOEVERYMODEOF WINDINGUP

Proof and Ranking of Claims

309. In every winding up (subject in the case of insolvent companies to the application in accordance with the provisions of thisAct of the law of bankruptcy) all debts payable on a contingency, and all claims against thecompany, presentor future, certainorcontingent, ascertained or sounding only in damages, shall be admissible to proof against the company, a just estimate being made, so far as possible, of the value of such debts or claims as may be subject to any contingency or sound only in damages or for some other reason do not bear a certain value.

310. In the winding up of an insolvent company the same rules shall prevail and be observed with regard to the respective rights of secured and unsecured creditors and to debts provable and to the valuation of annuities and future and contingent liabilities as are in force for the time being under the law of bankruptcy with respect to the estates of persons adjudged bankrupt, and all persons who in any such case would be entitled to prove for and receive dividends out of the assets of the company may come in under the winding up, and make such claims against the company as they respectively are entitled to by virtue of this section.

311.—(1) In a winding up there shall be paid in priority to all other debts—

(a) all rates, charges, taxes, assessments,or impositions,whether imposed or made by the Government or by any public authorityunder theprovisionsofany law,andhavingbecome due and payable within twelve months next before the relevant date and not exceeding in the whole one year’s

Debts of all description to be proved.

Application of bankruptcy rules in winding up of insolvent companies.

Preferential payments.

[No. ] The Companies Act, 2004218

assessment;

(b) all wages or salary (whether or not earned wholly or in part by way of commission) of any clerk or servant in respect of services rendered to the company during four months next before the relevant date, and all wages (whether payable for time or for piece work), of any workman or labourer in respect of services so rendered:

Provided that the sum to which priority is to be given under thisparagraphshallnot, in thecaseofanyoneclaimant, exceed two hundred thousand dollars;

(c) unless thecompany isbeingwoundupvoluntarilymerelyfor the purposes of reconstruction or of amalgamation with another company, or unless the company has at the commencementof thewindingupunder suchacontractwith insurers as is mentioned in section 21 of the Workmen’s Compensation Act, rights capable of being transferred to and vested in the workman, all amounts due in respect of any compensation or liability for compensation under that Act accrued before the relevant date;

(d) all amounts by way of contributions for which the company is liable pursuant to sections 4, 5 and 6 of the National Insurance Act and which have become due and payable before the relevant date;

(e) redundancy payments payable under the Employment (Termination and Redundancy Payments)Act whether such payments fall due before or after the appointment of a liquidator;

(f) all amounts by way of contributions for which the company is liable pursuant to sections 11 and 12 of the National HousingTrustAct and which have become due and payable before the relevant date.

(2) Where any compensation under the Workmen’s Com- pensationAct is a weekly payment, the amount due in respect thereof shall, for the purposes of paragraph (c) of subsection (1), be taken to

219The Companies Act, 2004 [No. ]

be the amount of the lump sum for which the weekly payment could, if redeemable, be redeemed if the employer made an application for that purpose under thatAct.

(3) Where any payment on account of wages or salary has been made to any clerk, servant, workman or labourer in the employment of a company out of money advanced by some person for that purpose, that person shall in a winding up have a right of priority in respect of the money so advanced and paid up to the amount by which the sum in respect of which that clerk, servant, workman or labourer wouldhavebeenentitledtopriorityinthewindinguphasbeendiminished by reason of the payment having been made.

(4) The foregoing debts shall—

(a) rankequallyamong themselvesandbepaid in full, unless the assets are insufficient to meet them, in which case they shall abate in equal proportions; and

(b) in the case of a company registered in the Island, so far as the assets of the company available for payment of general creditors are insufficient to meet them, have priority over the claims of holders of debentures under any floating charge created by the company, and be paid accordingly out of any property comprised in or subject to that charge.

(5) Subject to the retention of such sums as may be necessary for the costs and expenses of the winding up, the foregoing debts shall be discharged forthwith so far as the assets are sufficient to meet them.

(6) In this section theexpression“therelevantdate”means—

(a) in the case of a company ordered to be wound up compulsorily which had not previously commenced to be wound up voluntarily, the date of the winding up order; and

(b) in any other case, the date of the commencement of the windingup.

[No. ] The Companies Act, 2004220

Effect of Winding Up on Antecedent and other Transactions

312.—(1) Any conveyance, mortgage, delivery of goods, payment, execution, or other act relating to property which would, if made or donebyoragainstanindividual,bedeemedinhisbankruptcyafraudulent preference, or a fraudulent conveyance, assignment, transfer, sale or disposition, shall, if made or done by or against a company, be deemed, in theeventof itsbeingwoundup,a fraudulentpreferenceof itscreditors, or a fraudulent conveyance, assignment, transfer, sale or disposition, as the case may be, and be invalid accordingly.

(2) For the purposes of this section, the commencement of the winding up shall be deemed to correspond with the presentation of the bankruptcy petition in the case of an individual.

(3) Any conveyance or assignment by a company of all its property to trustees for the benefit of all its creditors shall be void to all intents.

313.—(1) Where, in the case of a company wound up in the Island, anything made or done after the appointed day is void under section 312 as a fraudulent preference of a person interested in property mortgaged or charged to secure the company's debt, then (without prejudice to any rights or liabilities arising apart from this provision) the person preferred shall be subject to the same liabilities, and shall have the same rights, as if he had undertaken to be personally liable as surety for the debt to the extent of the charge on the property or the value of his interest, whichever is the less.

(2) The value of that person’s interest shall be determined as at the date of the transaction constituting the fraudulent preference, and shall be determined as if the interest were free of all incumbrances other than those to which the charge for the company’s debt was then subject.

(3) On any application made to the Court with respect to any paymentonthegroundthat thepaymentwasafraudulentpreference of a surety or guarantor, the Court shall have jurisdiction to determine any questions with respect to the payment arising between the person to whom the payment was made and the surety or guarantor and to grant relief in respect thereof, notwithstanding that it is not necessary so

Fraudulent preference.

Liabilities and rights of certain fraudulently preferred person.

221The Companies Act, 2004 [No. ]

to do for the purposes of the winding up, and for that purpose may give leave to bring in the surety or guarantor as a third party as in the case of an action for the recovery of the sum paid.

(4) Subsection (3) shall apply, with the necessary modifications, inrelationtotransactionsother thanthepaymentofmoney as it applies in relation to payments.

314. Where a company is being wound up, a floating charge on the undertaking or property of the company created within twelve months of the commencement of the winding up shall, unless it is proved that the company immediately after the creation of the charge was solvent, be invalid, except to the amount of any cash paid to the company at the time of or subsequently to the creation of, and in consideration for, the charge, togetherwith intereston thatamountat the rateof sixpercentum per annum or such other rate as may for the time being be prescribed by order of the Minister.

315.—(1) Where any part of the property of a company which is being wound up consists of land of any tenure burdened with onerous covenants, of shares or stock in companies, unprofitable contracts, or any other property that is unsaleable, or not readily saleable, by reason of its binding the possessor thereof to the performance of any onerous act, or to the payment of any sum of money, the liquidator of the company, notwithstanding that he has endeavoured to sell or has taken possession of the property, or exercised any act of ownership in relation thereto, may, with the leave of the Court and subject to the provisions of this section, by writing signed by him, at any time within twelve months after the commencement of the winding up or such extended period as may be allowed by the Court, disclaim the property:

Provided that, where any such property has not come to the knowledge of the liquidator within one month after the commencement of the winding up, the power under this section of disclaiming the property may be exercised at any time within twelve months after he has become aware thereof or such extended period as may be allowed by the Court.

Effect of floating charge.

Disclaimer of onerous property.

[No. ] The Companies Act, 2004222

(2) The disclaimer shall operate to determine, as from the date of disclaimer, the rights, interest, and liabilities of the company, and the property of the company, in or in respect of the property disclaimed, but shall not, except so far as is necessary for the purpose of releasing thecompanyandthepropertyof thecompanyfromliability, affect the rights or liabilities of any other person.

(3) The Court, before or on granting leave to disclaim, may require such notices to be given to persons interested, and impose such terms as a condition of granting leave, and make such other order in the matter as the Court thinks just.

(4) Theliquidatorshallnotbeentitledtodisclaimanyproperty under this section in any case where an application in writing has been made to him by any persons interested in the property requiring him to decide whether he will or will not disclaim, and the liquidator has not, within a period of twenty-eight days after the receipt of the application or such further period as may be allowed by the Court, given notice to the applicant that he intends to apply to the Court for leave to disclaim, and, in the case of a contract, if the liquidator, after such an application as aforesaid, does not within that period or further period disclaim the contract, the company shall be deemed to have adopted it.

(5) The Court may, on the application of any person who is, as against the liquidator, entitled to the benefit or subject to the burden of a contract made with the company, make an order rescinding the contract on such terms as to payment by or to either party of damages for the non-performance of the contract, or otherwise as the Court thinks just, andanydamagespayableunder theorder toanysuchperson may be proved by him as a debt in the winding up.

(6) The Court may, on an application by any person who either claims any interest in any disclaimed property or is under any liability not discharged by thisAct in respect of any disclaimed property and on hearing any such persons as it thinks fit, make an order for the vesting of the property in or the delivery of the property to any persons entitled thereto, or to whom it may seem just that the property should be delivered by way of compensation for such liability as aforesaid, or a trustee for him, and on such terms as the Court thinks just, and on any

223The Companies Act, 2004 [No. ]

such vesting order being made, the property comprised therein shall vest accordingly in the person therein named in that behalf without any conveyance or assignment for the purpose:

Provided that, where the property disclaimed is of a leasehold nature, the Courtshallnotmakeavestingorder infavourof anypersonclaiming under thecompany,whetherasunder-lesseeorasmortgageebydemise, except upon the terms of making that person—

(a) subject to the same liabilities and obligations as those to which the company was subject under the lease in respect of the property at the commencement of the winding up; or

(b) if the Court thinks fit, subject only to the same liabilities and obligations as if the lease had been assigned to that person at that date,

and in either event (if the case so require) as if the lease had comprised only the property comprised in the vesting order.

(7) And any mortgagee or under-lessee declining to accept a vesting order upon the terms referred to in paragraphs (a) and (b) of the proviso to subsection (6) shall be excluded from all interest in and security upon the property, and, if there is no person claiming under the company who is willing to accept an order upon such terms, the Court shall have power to vest the estate and interest of the company in the property in any person liable either personally or in a representative character, and either alone or jointly with the company to perform the lessee’s covenants in the lease, freed and discharged from all estates, incumbrances and interests created therein by the company.

(8) Any person injured by the operation of a disclaimer under this section shall be deemed to be a creditor of the company to the amount of the injury, and may accordingly prove the amount as a debt in the winding up.

316.—(1) Where a creditor has issued execution against the goods or lands of a company or has attached any debt due to the company, and the company is subsequently wound up, he shall not be entitled to

Restriction of rights of creditor as to execution or attachment.

[No. ] The Companies Act, 2004224

retain the benefit of the execution or attachment against the liquidator in the winding up of the company unless he has completed the execution or attachment before the commencement of the winding up:

Provided that—

(a) where any creditor has had notice of a meeting having been called at which a resolution for voluntary winding up is to be proposed, the date on which the creditor so had notice shall for the purposes of the foregoing provision be substituted for the date of the commencement of the winding up;

(b) a person who purchases in good faith under a sale by a bailiff any goods of a company on which an execution has been levied shall in all cases acquire a good title to them against the liquidator; and

(c) the rights conferred by this subsection on the liquidator may be set aside by the Court in favour of the creditor to such extent and subject to such terms as the Court may think fit.

(2) For the purposes of this section, an execution against goods shall be taken to be completed by seizure and sale, and an attachment of a debt shall be deemed to be completed by receipt of the debt and an execution against land shall be deemed to be completed from the date of the order for sale or by seizure as the case may be, and, in thecaseofanequitable interest, by theappointmentofa receiver.

(3) In this section and in section 317 the expression “goods” includes all chattels personal, and the expression “bailiff” includes any officer charged with the execution of a writ or other process.

317.—(1) Subject to the provisions of subsection (3), where any goods of a company are taken in execution, and, before the sale thereof or the completion of the execution by the receipt or recovery of the full amount of the levy, notice is served on the bailiff that a provisional liquidator has been appointed or that a winding up order has been made or that a resolution for voluntary winding up has been passed, the bailiff shall, on being so required, deliver the goods and any money seized or received in part satisfaction of the execution to the liquidator,

Duties of bailiff as to goods taken in execution.

225The Companies Act, 2004 [No. ]

but the costs of the execution shall be a first charge on the goods or moneysodelivered, and the liquidatormaysell thegoods,ora sufficient part thereof, for the purpose of satisfying that charge.

(2) Subject to the provisions of subsection (3), where un- der an execution in respect of a judgment for a sum exceeding two hundred thousand dollars the goods of a company are sold or money is paid in order to avoid sale, the bailiff shall deduct the costs of the ex- ecution from the proceeds of the sale or the money paid and retain the balance for fourteen days, and if within that time notice is served on him of a petition for the winding up of the company having been presented or of a meeting having been called at which there is to be proposed a resolution for the voluntary winding up of the company and an order is made or a resolution is passed, as the case may be, for the winding up of the company, the bailiff shall pay the balance to the liquidator, who shall be entitled to retain it as against the execution creditor.

(3) The rights conferred by this section on the liquidator may be set aside by the Court in favour of the creditor to such extent and subject to such terms as the Court thinks fit.

Offences Antecedent to or in Course of Winding up

318.—(1) If anyperson,beingapastor presentofficerof acompany which at the time of the commission of the alleged offence is being woundup,whetherbyorunder thesupervisionoftheCourtorvoluntarily, or is subsequently ordered to be wound up by the Court or subsequently passes a resolution for voluntary winding up—

(a) does not to the best of his knowledge and belief fully and truly discover to the liquidator all the property, real and personal, of the company, and how and to whom and for what consideration and when the company disposed of any part thereof, except such part as has been disposed of in the ordinary way of the business of the company; or

(b) does not deliver up to the liquidator, or as he directs, all such part of the real and personal property of the company as is in his custody or under his control, and which he is required by law to deliver up; or

Offences by officers of companies in liquidation.

[No. ] The Companies Act, 2004226

(c) does not deliver up to the liquidator, or as he directs, all books and papers in his custody or under his control belonging to the company and which he is required by law to deliver up; or

(d) within twelve months next before the commencement of the winding up or at any time thereafter conceals any part of the property of the company to the value of five thousand dollars or upwards, or conceals any debt due to or from the company; or

(e) within twelve months next before the commencement of the winding up or at any time thereafter fraudulently removes any part of the property of the company to the value of five thousand dollars or upwards; or

(f) makes any material omission in any statement relating to the affairs of the company; or

(g) knowing or believing that a false debt has been proved by any person under the winding up, fails for the period of a month to inform the liquidator thereof; or

(h) after the commencement of the winding up prevents the production of any book or paper affecting or relating to the property or affairs of the company; or

(i) within twelve months next before the commencement of the winding up or at any time thereafter, conceals, destroys, mutilates, or falsifies, or is privy to the concealment, destruction, mutilation, or falsification of, any book or paper affectingor relating to thepropertyoraffairsof thecompany; or

(j) within twelve months next before the commencement of the winding up or at any time thereafter makes or is privy to the making of any false entry in any book or paper affecting or relating to the property or affairs of the company; or

(k) within twelve months next before the commencement of the winding up or at any time thereafter fraudulently parts with, alters, or makes any omission in, or is privy to the fraudulent

227The Companies Act, 2004 [No. ]

parting with, altering, or making any omission in, any document affecting or relating to the property or affairs of the company; or

(1) after thecommencementof thewindinguporat anymeeting of the creditors of the company within twelve months next before the commencement of the winding up attempts to account for any part of the property of the company by fictitious losses or expenses; or

(m) has within twelve months next before the commencement of the winding up or at any time thereafter, by any false representation or other fraud, obtained any property for or on behalf of the company on credit which the company does not subsequently pay for; or

(n) within twelve months next before the commencementof the winding up or at any time thereafter, under the false pretence that thecompanyiscarryingon itsbusiness,obtainsoncredit, for or on behalf of the company, any property which the company does not subsequently pay for; or

(o) within twelve months next before the commencement of the winding up or at any time thereafter pawns, pledges, or disposes of any property of the company which has been obtained on credit and has not been paid for, unless such pawning, pledging, or disposing is in the ordinary way of the business of the company; or

(p) is guilty of any false representation or other fraud for the purpose of obtaining the consent of the creditors of the company or any of them to an agreement with reference to the affairs of the company or to the winding up,

he shall be guilty of an offence.

(2) Aperson convicted of an offence—

(a) under paragraph (a), (b), (c), (d), (e), (f), (g), (h), (i), (j), (k), (1) or (p) of subsection (1) shall be liable—

(i) on conviction in a Circuit Court, to a fine or to imprisonment for a term not exceeding two years or to both such fine and imprisonment;

[No. ] The Companies Act, 2004228

(ii) on summary conviction before a Resident Magistrate, to a fine not exceeding three million dollars or to imprisonment for a term not exceeding twelve months or to both such fine and imprisonment;

(b) under paragraph (m), (n) or (o) of that subsection shall be liable—

(i) on conviction in a Circuit Court to a fine or to imprisonment for a term not exceeding five years or to both such fine and imprisonment;

(ii) on summary conviction before a Resident Magistrate, to a fine not exceeding five million dollars or to imprisonment for a term not exceeding twelve months or to both such fine and imprisonment.

(3) It shall be a good defence to a charge under any of paragraphs (a), (b), (c), (d), (f), (n) and (o), if the accused proves that he had no intent to defraud, and to a charge under any of paragraphs (h), (i) and (j), if he proves that he had no intent to conceal the state of affairs of the company or to defeat the law.

(4) Where any person pawns, pledges or disposes of any property in circumstances which amount to an offence under paragraph (o) of subsection (1), every person who takes in pawn or pledge or otherwise receives the property knowing it to be pawned, pledged, or disposed of in such circumstances as aforesaid shall be guilty of an offence, and shall be liable—

(a) on conviction in a Circuit Court to a fine or to imprisonment for a term not exceeding five years or to both such fine and imprisonment;

(b) on summary conviction before a Resident Magistrate to a fine not exceeding three million dollars or to imprisonment for a term not exceeding twelve months or to both such fine and imprisonment.

229The Companies Act, 2004 [No. ]

(5) For the purposes of this section, the expression “officer” shall include any person in accordance with whose directions or instructions the directors of a company have been accustomed to act.

319. If any officer or contributory of any company being wound up destroys, mutilates, alters, or falsifies any books, papers, or securities, or makes or is privy to the making of any false or fraudulent entry in any register, book of account, or document belonging to the company with intent to defraud or deceive any person, he shall be guilty of an offence and on conviction thereof he shall be liable to a fine not exceeding two million dollars or to imprisonment with or without hard labour for a term not exceeding two years or to both such fine and imprisonment.

320. If any person, being at the time of the commission of the alleged offence an officer of a company which is subsequently ordered to be wound up by the Court or subsequently passes a resolution for voluntarywindingup—

(a) hasbyfalsepretencesorbymeansofanyother fraud induced any person to give credit to the company;

(b) with intent to defraud creditors of the company, has made or caused to be made any gift or transfer of or charge on, or hascausedorconnivedat thelevyingofanyexecutionagainst, the property of the company;

(c) with intent to defraud creditors of the company, has concealed or removed any part of the property of the company since, or within two months before, the date of any unsatisfied judgment or order for payment of money obtained against the company,

he shall be guilty of an offence and shall be liable—

(i) on conviction in a Circuit Court to a fine or to imprisonment with or without hard labour for a term not exceeding two years or to both such fine and imprisonment; or

(ii) on summary conviction before a Resident Magistrate to a fine not exceeding three million

Penalty for falsification of books.

Fraud by officers of companies which have gone into liquidation.

[No. ] The Companies Act, 2004230

dollars or to imprisonment with or without hard labour for a term not exceeding twelve months or to both such fine and imprisonment.

321.—(1) If where a company is wound up it is shown that proper books of account were not kept by the company throughout the period of two years immediately preceding the commencement of the winding up, or the period between the incorporation of the company and the commencementof thewindingup,whichever is theshorter,everyofficer of thecompanywhowasknowinglyaparty toorconnivedat thedefault of the company shall, unless he shows that he acted honestly and that in the circumstances in which the business of the company was carried on the default was excusable, be guilty of an offence and shall be liable—

(a) on conviction in a Circuit Court to a fine or to imprisonment with or without hard labour for a term not exceeding one year; or

(b) on summary conviction before a Resident Magistrate to a finenotexceeding twomilliondollarsor to imprisonment for a term not exceeding six months.

(2) For the purposes of this section, proper books of account shall be deemed not to have been kept in the case of any company if there have not been kept such books or accounts as are necessary to exhibit and explain the transactions and financial position of the trade or business of the company, including books containing entries from day to day in sufficient detail of all cash received and cash paid, and, where the trade or business has involved dealings in goods, statements of the annual stocktakings and (except in the case of goods sold by way of ordinary retail trade) of all goods sold and purchased, showing the goods and the buyers and sellers thereof in sufficient detail to enable those goods and those buyers and sellers to be identified.

322.—(1) If in the course of the winding up of a company it appears that any business of the company has been carried on with intent to defraud creditors of the company, creditors of any other person or for any fraudulent purpose, the Court, on the application of the Trustee, or the liquidator or any creditor or contributory of the company, may, if it

Liability where proper accounts not kept.

Responsibility for fraudulent trading of persons concerned.

231The Companies Act, 2004 [No. ]

thinks proper so to do, declare that any persons who were knowingly parties to the carrying on of the business in manner aforesaid shall be personally responsible,withoutany limitationof liability, for all or any of the debts or other liabilities of the company as the Court may direct.

(2) On the hearing of an application under subsection (1) the Trustee or the liquidator, as the case may be, may himself give evidence or call witnesses.

(3) Where the Court makes any such declaration, it may give such further directions as it thinks proper for the purpose of giving effect tothatdeclaration,andinparticularmaymakeprovisionformaking the liability of any such person under the declaration a charge on any debt or obligation due from the company to him, or on any mortgage or charge or any interest in any mortgage or charge on any assets of the company held by or vested in him, or any company or person on his behalf, or any person claiming as assignee from or through the person liable or any company or person acting on his behalf, and may from time to time make such further order as may be necessary for the purpose of enforcing any charge imposed under this subsection.

(4) For the purpose of subsection (3), the expression “assignee” includes any person to whom or in whose favour, by the directions of the person liable, the debt, obligation, mortgage or charge was created, issued or transferred or the interest created, but does not include an assignee for valuable consideration (not including consideration by way of marriage) given in good faith and without notice of any of the matters on the ground of which the declaration is made.

(5) Where any business of a company is carried on with such intent or for such purpose as is mentioned in subsection (1), every person who was knowingly a party to the carrying on of the business in manner aforesaid, shall be liable on conviction on indictment to imprisonment with or without hard labour for a term not exceeding two years or to a fine not exceeding fifty thousand dollars or to both such imprisonmentandfine.

[No. ] The Companies Act, 2004232

(6) The provisions of this section shall have effect notwithstanding that the person concerned may be criminally liable in respect of the matters on the ground of which the declaration is to be made, and where the declaration under subsection (1) is made in the case of a winding up, the declaration shall be deemed to be a final judgment within the meaning of paragraph (h) of section 19 of the BankruptcyAct.

323.—(1) If in the course of winding up a company it appears that any person who has taken part in the formation or promotion of the company, or any past or present officer or liquidator of the company, has misapplied or retained or become liable or accountable for any money or property of the company, or been guilty of any misfeasance or breach of trust in relation to the company, the Court may, on the application of the Trustee, or of the liquidator, or of any creditor or contributory, examine into the conduct of the promoter, liquidator, or officer, and compel him to repay or restore the money or property or any part thereof respectively with interest at such rate as the Court thinks just, or to contribute such sum to the assets of the company by way of compensation in respect of the mis-application, retainer, misfeasance, or breach of trust as the Court thinks just.

(2) The provisions of this section shall have effect notwith- standing that theoffence isone forwhich theoffendermaybecriminally liable.

(3) Where in the case of a winding up an order for payment of money is made under this section, the order shall be deemed to be a final judgment within the meaning of paragraph (h) of section 19 of the BankruptcyAct.

324.—(1) If it appears to the Court in the course of a winding up by, or subject to the supervision of, the Court that any past or present officer, or any member, of the company has been guilty of any offence in relation to the company for which he is criminally liable, the Court may, either on the application of any person interested in the winding up or of its own motion, direct the liquidator to refer the matter to the Director of Public Prosecutions.

Power of Court to assess damages against delinquent directors, etc.

Prosecution of delinquent officers and members of company.

233The Companies Act, 2004 [No. ]

(2) If it appears to the liquidator in the course of a voluntary winding up that any past or present officer, or any member, of a company has been guilty of any offence in relation to the company for which he is criminally liable, he shall forthwith report the matter to the Director of Public Prosecutions, and shall furnish to the Director such information and give to him such access to and facilities for inspecting and taking copies of any documents, being information or documents in the possession or under the control of the liquidator and relating to the matter in question, as the Director may require.

(3) Where any report is made under subsection (2) to the Director of Public Prosecutions, he may, if he thinks fit, refer the matter to the Minister for further enquiry, and the Minister shall thereupon investigate the matter and may, if he thinks it expedient, apply to the Court for an order conferring on the Minister or any person designated by the Minister for the purpose with respect to the company concerned all such powers of investigating the affairs of the company as are provided by thisAct in the case of a winding up by the Court.

(4) If it appears to the Court in the course of a voluntary winding up that any past or present officer, or any member, of the company has been guilty as aforesaid, and that no report with respect to the matter has been made by the liquidator to the Director of Public Prosecutions under subsection (2), the Court may, on the application of any person interested in the winding up or of its own motion, direct the liquidator to make such a report, and on a report being made accordingly theprovisionsof this sectionshall haveeffect as though the report had been made in pursuance of the provisions of subsection (2).

(5) Where any matter is reported or referred to the Director of Public Prosecutions under this section, if he considers that the case is one in which a prosecution ought to be instituted, he shall institute proceedings accordingly, and it shall be the duty of the liquidator and of every officer and agent of the company past and present (other than thedefendant in theproceedings) togivehimallassistance inconnection with the prosecution which he is reasonably able to give.

[No. ] The Companies Act, 2004234

(6) For thepurposesofsubsection(5) theexpression“agent” in relation to a company shall be deemed to include any banker or attorney-at-law of the company and any person employed by the company as auditor, whether that person is or is not an officer of the company.

(7) Ifanypersonfailsorneglects togiveassistance inmanner required by subsection (5), the Court may, on the application of the Director of Public Prosecutions, direct that person to comply with the requirements of that subsection, and where any such application is made with respect to a liquidator the Court may, unless it appears that the failure or neglect to comply was due to the liquidator not having in his hands sufficient assets of the company to enable him so to do, direct that the costs of the application shall be borne by the liquidator personally.

Supplementary Provisions as to Winding up

325. A body corporate shall not be qualified for appointment as liquidator of a company, whether in a winding up by or under the supervision of the Court or in a voluntary winding up, and—

(a) any appointment made in contravention of this provision shall be void; and

(b) any body corporate which acts as liquidator of a company shall be liable to a fine not exceeding fifty thousand dollars.

326.—(1) If any liquidator, who has made any default in filing, deliveringormakinganyreturn, accountorotherdocument,or ingiving anynoticewhichhe isby lawrequired to file, deliver,makeorgive, fails to make good the default within fourteen days after the service on him of a notice requiring him to do so, the Court may, on an application made to the Court by any contributory or creditor of the company or by the Registrar, make an order directing the liquidator to make good the default within such time as may be specified in the order.

(2) Anysuchordermayprovidethatallcostsofandincidental to the application shall be borne by the liquidator.

(3) Nothing in this section shall be taken to prejudice the operationofanyenactment imposingpenaltiesona liquidator in respect of any such default as aforesaid.

Disqualifica- tion for appointment as liquidator.

Enforcement of duty of liquidator to make returns, etc.

235The Companies Act, 2004 [No. ]

327.—(1) Where a company is being wound up, whether by or under the supervision of the Court or voluntarily, every invoice, order for goods or business letter issued by or on behalf of the company or a liquidator of the company, or a receiver or manager of the property of thecompany,beingadocumentonor inwhich thenameof thecompany appears, shall contain a statement that the company is being wound up.

(2) If default is made in complying with this section the company and every officer of the company, and every liquidator of the company and every receiver or manager, who knowingly and wilfully authorizes or permits the default shall be liable to a fine not exceeding fifty thousand dollars.

328.—(1) In the case of a winding up by the Court, or of a creditors’ voluntary winding up, of a company—

(a) every assurance relating solely to freehold or leasehold property, or to any mortgage, charge or other incumbrance on, or any estate, right or interest in, any real or personal property, which forms part of the assets of the company and which, after the execution of the assurance, either at law or in equity, is or remains part of the assets of the company; and

(b) every power of attorney, proxy paper, writ, order, certificate, affidavit, bond or other instrument or writing relating solely to the property of any company which is being so wound up, or to any proceeding under any such winding up,

shall be exempt from duties chargeable under the enactments relating to stamp duties.

(2) In subsection (1) the expression “assurance” includes deed, conveyance, assignment, transfer and surrender.

329. Where a company is being wound up, all books and papers of the company and of the liquidators shall, as between the contributories of the company, be prima facie evidence of the truth of all matters purporting to be therein recorded.

Notification that company is in liquidation.

Exemption of certain documents from stamp duty on winding up of companies.

Books of company to be evidence.

[No. ] The Companies Act, 2004236

330.—(1) When a company has been wound up and is about to be dissolved, the books and papers of the company and of the liquidators may be disposed of as follows, that is to say—

(a) in the case of a winding up by or subject to the supervision of the Court, in such way as the Court directs;

(b) in the case of a members’ voluntary winding up, in such way as the company by extraordinary resolution directs, and, in the case of a creditors’ voluntary winding up, in such way as the committee of inspection or, if there is no such committee, as the creditors of the company, may direct.

(2) After five years from the dissolution of the company no responsibility shall rest on the company, the liquidators, or any person to whom the custody of the books and papers has been committed, by reason of any book or paper not being forthcoming to any person claiming to be interested therein.

(3) Provision may be made by rules for enabling the Court toprevent, for suchperiod(notexceedingfiveyears fromthedissolution of the company) as the Court thinks proper, the destruction of the books and papers of a company which has been wound up, and for enabling any creditor or contributory of the company to make representations to the Court.

(4) If any person acts in contravention of any rules made for the purposes of this section or of any direction of the Court thereunder, he shall be liable to a fine not exceeding three thousand dollars.

331.—(1) If the winding up of a company is not concluded within one year after its commencement, the liquidator shall, at such intervals as may be prescribed, until the winding up is concluded, send to the Registrarastatement in theprescribedformandcontainingtheprescribed particulars with respect to the proceedings in and position of the liquidation.

(2) Any person stating himself in writing to be a creditor or contributoryof thecompanyshallbeentitled,byhimselforbyhisagent, at all reasonable times, on payment of the prescribed fee, to inspect the statement, and to receive a copy thereof or extract therefrom.

Disposal of books and papers of company.

Information as to pending liquidations.

237The Companies Act, 2004 [No. ]

(3) If a liquidator fails to comply with this section, he shall be liable toa finenot exceeding fivehundreddollars for eachdayduring which the default continues, and any person untruthfully stating himself as aforesaid to be a creditor or contributory shall be guilty of a contempt of court, and shall, on the application of the liquidator or of theTrustee, be punishable accordingly.

332.—(1) If it appearseither fromanystatement sent to theRegistrar under section 331 or otherwise that a liquidator has in his hands or under his control any money representing unclaimed or undistributed assets of the company which have remained unclaimed or undistributed for six months after the date of their receipt or any money held by the company in trust in respectofdividendsorother sumsdue toanyperson as a member of the company, the liquidator shall forthwith pay that money into Court, and shall be entitled to the prescribed certificate of receipt for the money so paid, and that certificate shall be an effectual discharge to him in respect thereof.

(2) Any person claiming to be entitled to any money paid into Court in pursuance of this section may apply to the Court for payment thereof, and the Court may, on a certificate by the liquidator that the person claiming is entitled, make an order for the payment to that person of the sum due.

333. Where after the appointed day a resolution is passed at an adjourned meeting of any creditors or contributories of a company, the resolution shall, for all purposes, be treated as having been passed on the date on which it was in fact passed, and shall not be deemed to have been passed on any earlier date.

Supplementary Powers of Court

334.—(1)The Court may, as to all matters relating to the winding up of acompany,haveregard to thewishesof thecreditorsorcontributories of the company, as proved to it by any sufficient evidence, and may, if it thinks fit, for thepurposeofascertaining thosewishes,directmeetings of the creditors or contributories to be called, held, and conducted in such manner as the Court directs, and may appoint a person to act as chairman of any such meeting and to report the result thereof to the Court.

Unclaimed assets.

Resolutions passed at adjourned meetings of creditors and contributors.

Meetings to ascertain wishes of creditors or contributories.

[No. ] The Companies Act, 2004238

(2) In the case of creditors, regard shall be had to the value of each creditor’s debt.

(3) In the case of contributories, regard shall be had to the number of votes conferred on each contributory by this Act or the articles.

335.—(1) Any affidavit required to be sworn under the provisions or for the purposes of this Part may be sworn in the Island, or elsewhere within the Commonwealth, before any court, judge, or person lawfully authorized to take and receive affidavits, or, in any place outside the Commonwealth, before any of Her Majesty’s consuls or vice-consuls or a notary public, subject to the like restrictions as apply in relation to the power of a notary public in a foreign state or country under section 152 of the Registration of TitlesAct to attest instruments and powers of attorney under thatAct.

(2) All courts, judges justices, commissioners and persons acting judiciallyshall takejudicialnoticeof thesealorstamporsignature, as the case may be, of any such court, judge, person, consul, vice- consul or notary public attached, appended, or subscribed to any such affidavit, or to any other document to be used for the purposes of this Part.

Provisions as to Dissolution

336.—(1) Where a company has been dissolved, the Court may at any time within two years of the date of the dissolution, on an applicationbeingmade for thepurposeby the liquidatorof thecompany or by any other person who appears to the Court to be interested, make an order, upon such terms as the Court thinks fit, declaring the dissolution to have been void, and thereupon such proceedings may be taken as might have been taken if the company had not been dissolved.

(2) It shall be the duty of the person on whose application the order was made, within seven days after the making of the order, or such further time as the Court may allow, to deliver to the Registrar for registration a copy of the order, and if that person fails so to do he shall be liable to a fine not exceeding two thousand dollars for every day during which the default continues.

Affidavits, etc.

Power of Court to declare dissolution of company void.

239The Companies Act, 2004 [No. ]

337.—(1) Where the Registrar has reasonable cause to believe that a company is not carrying on business or in operation, he may send to the companyby post a letter inquiringwhether thecompany iscarrying on business or in operation.

(2) If the Registrar does not within one month of sending the letter receive any answer thereto, he shall within fourteen days after the expiration of the month send to the company by post a registered letter referring to the first letter, and stating that no answer thereto has been received, and that if an answer is not received to the second letter within one month from the date thereof, a noticewill be published in the Gazette and in a daily newspaper circulating in the Island with a view to striking the name of the company off the register.

(3) If the Registrar either receives an answer to the effect that the company is not carrying on business or in operation, or does notwithinonemonthafter sending thesecond letter receiveanyanswer, he may publish in the Gazette and in a daily newspaper circulating in theIsland,andsendto thecompanybypost, anotice thatat theexpiration of three months from the date of that notice the name of the company mentioned therein will, unless cause is shown to the contrary, be struck off the register and the company will be dissolved.

(4) If, in any case where a company is being wound up, the Registrar has reasonable cause to believe either that no liquidator is acting, or that the affairs of the company are fully wound up, and the returns required to be made by the liquidator have not been made for a period of six consecutive months, the Registrar shall publish in the Gazette and send to the company or the liquidator, if any, a like notice as is provided in subsection (3).

(5) At the expiration of the time mentioned in the notice the Registrar may, unless cause to the contrary is previously shown by the company, strike itsnameoff the register, andshallpublishnotice thereof in the Gazette, and on the publication in the Gazette of that notice the company shall be dissolved:

Provided that—

(a) the liability, if any, of every director, managing officer, and member of the company shall continue and may be enforced as if the company had not been dissolved; and

Registrar may strike defunct company off register.

[No. ] The Companies Act, 2004240

(b) nothing in this subsection shall affect the power of the Court to wind up a company the name of which has been struck off the register.

(6) If a company or any member or creditor thereof feels aggrieved by the company having been struck off the register, the Registraronanapplicationmadeby thecompanyormemberorcreditor before theexpirationof twentyyears fromthepublication in the Gazette of the notice aforesaid may, if satisfied that—

(a) the company was at the time of the striking off, carrying on business or in operation; or

(b) otherwise that it is just that the company be restored to the register,

order the name of the company to be restored to the register and upon such registration, the company shall be deemed to have continued in existence as if its name had not been struck off.

(7) Anotice to be sent under this section to a liquidator may be addressed to the liquidator at his last known place of business, and a letter or notice to be sent under this section to a company shall be addressed—

(a) to the company at its registered office and to some director or other officer of the company; or

(b) if there isnodirectororotherofficerwhosenameandaddress are known to the Registrar, to each of the persons who subscribed the articles, addressed to him at the address mentioned in the articles.

338.—(1) Where a company is dissolved, all property and rights whatsoever vested in or held on trust for the company immediately before its dissolution (including leasehold property but not including property held by the company on trust for any other person) shall, subject and without prejudice to any order which may at any time be made by the Court under section 336 or by the Registrar under section 337—

(a) prior to the expiration of two years referred to in section 336 (1) be held on trust by the Crown for the members of that company for the duration of two years; or

Property of dissolved company to be bona vacantia.

241The Companies Act, 2004 [No. ]

(b) prior to the expiration of the period of twenty years referred to in section 337 (6) be held on trust by the Crown for the members of that company for the duration of the twenty years; and

(c) after the expiration of the relevant period be deemed to be bona vacantia and shall accordingly belong to the Crown, and shall vest and may be dealt with in the same manner as other bona vacantia accruing to the Crown.

(2) Where a company is restored, the trust referred to in subsection (1) shall be extinquished and the property shall revert to the company.

(3) Where the Crown holds property for a dissolved Company on trust, the Crown shall not be liable—

(a) to manage the property;

(b) for any loss or damage to the property;

(c) for waste; or

(d) in respect of any claim by a third party.

(4) Where the Crown holds property for a dissolved company on trust in the case of—

(a) real property, it shall be held by the Commissioner of Lands;

(b) personalty, it shall be held by theAccountant General.

339.—(1) Where any property vests in the Crown under section 338(i) (c) theCrown’s title theretounder that sectionmaybedisclaimed by a notice signed by theAdministrator-General.

(2) Where a notice of disclaimer under this section is executed as respects any property, that property shall be deemed not to have vested in the Crown under section 338 (i) (c), and subsections (2) and (6) of section 315 shall apply in relation to the property as if it had been disclaimed under subsection (1) of that section immediately before the dissolution of the company.

(3) The right to execute a notice of disclaimer under this section may be waived by or on behalf of the Crown either expressly or by taking possession or other act evincing that intention.

Power of Crown to disclaim title to property vesting under section 335.

[No. ] The Companies Act, 2004242

(4) Anotice of disclaimer under this section shall be of no effect unless it is executed within twelve months of the date on which the vesting of the property as aforesaid came to the notice of the Administrator-General or, if an application in writing is made to the Administrator-Generalbyanypersoninterested in thepropertyrequiring him to decide whether he will or will not disclaim, within a period of three months after the receipt of the application or such further period as may be allowed by the Court.

(5) A statement in a notice of disclaimer of any property under this section that the vesting of the property came to the notice of theAdministrator-Generalonaspecifieddateor thatnosuchapplication as aforesaid was received by him with respect to the property before a specified date shall, until the contrary is proved, be sufficient evidence of the fact stated.

(6) Anoticeofdisclaimerunder thissectionshallbedelivered to the Registrar and retained and registered by him, and copies thereof shall be published in the Gazette and sent to any persons who have given theAdministrator-General notice that they claim to be interested in the property.

Rules and Fees

340.—(1) The Rules Committee of the Supreme Court established by section 3 of the Judicature (Rules of Court) Act, may, with the concurrenceof theMinister,makerulesforcarryingintoeffect theobjects of thisAct so far as relates to the winding up of companies, and all such rules shall be judicially noticed and shall have effect as if enacted in this Act.

(2) There shall be paid in respect of proceedings under this Act in relation to the winding up of companies such fees as the Rules Committeemay,with thesanctionof theMinister responsiblefor finance, by order direct, and that Minister may direct by whom and in what manner the same are to be collected and accounted for.

(3) All rules made under subsection (1) and all orders made under subsection (2) shall be subject to negative resolution.

(4) Until varied or revoked pursuant to the powers given by subsection (1) or, as the case may be, subsection (2), the Companies (Winding up) Rules, 1949, made under the 11 and 12 CompaniesAct, 1948, of the United Kingdom and the scale of winding up fees in force

11 and 12 Geo. 6 cap. 38.

Rules and fees for winding up.

243The Companies Act, 2004 [No. ]

under the saidAct are declared to be in force in the Island and shall be read with and construed as part of thisAct:

Provided that it shall be lawful for any court to make such alterations to those Rules as may be deemed expedient to render the same applicable to any matters before such court, so, however, that any such alteration shall not be inconsistent with the provisions of thisAct.

(5) Notwithstanding anything to the contrary, the Judicature (Rules of Court)Act shall not apply in relation to any matter for which provision is made in this section.

PART VI—RECEIVERS AND MANAGERS

341.—(1)Abody corporate shall not be qualified for appointment as receiver of the property of a company and any body corporate which acts as such a receiver shall be liable to a fine not exceeding fifty thousand dollars.

(2) If any person being an undischarged bankrupt acts as receiverormanagerof thepropertyofacompanyonbehalfofdebenture holders, he shall, subject to subsection (3), be liable on conviction on indictment to imprisonment with or without hard labour for a term not exceeding two years, or on summary conviction before a Resident Magistrate to imprisonment with or without hard labour for a term not exceeding six months or to a fine not exceeding fifty thousand dollars or to both such imprisonment and fine.

(3) Subsection (2) shall not apply to a receiver or manager where—

(a) the appointment under which he acts and the bankruptcy were both before the appointed day; or

(b) he acts under an appointment made by order of a court.

342. Where an application is made to the Court to appoint a receiver on behalf of the debenture holders or other creditors of a company which is being wound up by the Court, the Trustee may be so appointed.

Disqualifica- tion for appointment as receiver and for acting as receiver or manager.

Power to appoint Trustee as receiver for debenture holders or creditors.

[No. ] The Companies Act, 2004244

343.—(1) Where a receiver or manager of the property of a company has been appointed, every invoice, order for goods or business letter issued by or on behalf of the company or the receiver or manager or the liquidator of the company, being a document on or in which the name of the company appears, shall contain a statement that a receiver or manager has been appointed.

(2) If default is made in complying with the requirements of this section, the company and every officer of the company, and every liquidatorof thecompany,andeveryreceiverormanager,whoknowingly and wilfully authorizes or permits the default, shall be liable to a fine not exceeding fifty thousand dollars.

344.—(1) The Court may, on an application made to the Court by the liquidator of a company, by order fix the amount to be paid by way of remuneration to any person who, under the powers contained in any instrument, has been appointed as receiver or manager of the property of the company.

(2) The power of the Court under subsection (1) shall, where no previous order has been made with respect thereto under that subsection—

(a) extend to fixing the remuneration for any period before the making of the order or the application therefor; and

(b) be exercisable notwithstanding that the receiver or manager has died or ceased to act before the making of the order or the application therefor; and

(c) where the receiver or manager has been paid or has retained for his remuneration for any period before the making of the order any amount in excess of that so fixed for that period, extend to requiring him or his personal representatives to account for the excess or such part thereof as may be specified in the order:

Provided that the power conferred by paragraph (c) shall not be exercised as respects any period before the making of the application for the order unless in the opinion of the Court there are special

Notification that receiver or manager appointed.

Power of Court to fix remuneration on application of liquidator.

245The Companies Act, 2004 [No. ]

circumstances making it proper for the power to be so exercised.

(3) The Court may from time to time on an application made either by the liquidator or by the receiver or manager, vary or amend an order made under subsection (1).

(4) This section shall apply whether the receiver or manager was appointed before or after the appointed day, and to periods before, as well as to periods after, such day.

345.—(1) Where a receiver or manager of the whole or substantially the whole of the property of the company (hereafter in this section and in section 346 referred to as “the receiver”) is appointed on behalf of the holders of any debentures of the company secured by a floating charge, then subject to the provisions of this section and section 346—

(a) the receiver shall forthwith send notice to the company of his appointment; and

(b) there shall, within fourteen days after receipt of the notice, or such longer period as may be allowed by the Court or by the receiver, be made out and submitted to the receiver in accordance with section 346 a statement in the prescribed form as to the affairs of the company; and

(c) the receiver shall within two months after receipt of that statement send—

(i) to the Registrar and to the Court, a copy of the statementandofanycommentshesees fit tomake thereon and in the case of the Registrar also a summaryof thestatementandofhiscomments (if any) thereon; and

(ii) to the company, a copy of any such comments as aforesaid or, if he does not see fit to make any comment, a notice to that effect; and

Provisions as to informa- tion where receiver or manager appointed.

[No. ] The Companies Act, 2004246

(iii) toany trustees for thedebentureholdersonwhose behalf he was appointed and, so far as he is aware of their addresses, to all such debenture holders, a copy of the said summary.

(2) The receiver shall within two months, or such longer period as the Court may allow, after the expiration of the period of twelvemonthsfromthedateof hisappointmentandofeverysubsequent period of twelve months, and within two months or such longer period as the Court may allow after he ceases to act as receiver or manager of the property of the company, send to the Registrar, to any trustees for debenture holders of the company on whose behalf he was appointed, to the company and (so far as he is aware of their addresses) to all such debenture holders an abstract in the prescribed form showing his receipts and payments during that period of twelve months, or where he ceases to act as aforesaid, during the period from the end of the period to which the last preceding abstract related up to the date of his soceasing,andtheaggregateamountsofhis receiptsandofhispayments during all preceding periods since his appointment.

(3) Where the receiver is appointed under the powers contained in any instrument, this section shall have effect—

(a) with theomissionof the references to theCourt in subsection (1); and

(b) with the substitution for the references to the Court in subsection (2) of references to the Registrar.

(4) Subsection (1) shall not apply in relation to the appointment of a receiver or manager to act with an existing receiver or manager or in place of a receiver or manager dying or ceasing to act, except that, where that subsection applies to a receiver or manager who dies or ceases to act before it has been fully complied with, the references in paragraphs (b) and (c) thereof to the receiver shall (subject to subsection (5)) include references to his successor and to any continuing receiver or manager.

(5) Nothing in subsection (4) shall be taken as limiting the meaning of the expression “the receiver” where used in, or in relation to, subsection (2).

247The Companies Act, 2004 [No. ]

(6) This section and section 346, where the company is beingwoundup,shallapplynotwithstandingthat thereceiverormanager and the liquidator are the same person, but with any necessary modifications arising from that fact.

(7) Nothing in subsection (2) shall be taken to prejudice the duty of the receiver to render proper accounts of his receipts and payments to the persons to whom, and at the times at which, he may be required to do so apart from that subsection.

(8) If the receiver makes default in complying with the requirements of this section, he shall be liable to a fine not exceeding two thousand dollars for every day during which the default continues.

346.—(1) The statement as to the affairs of a company required by section 345 to be submitted to the receiver (or his successor) shall show as at the date of the receiver’s appointment the particulars of the company’s assets, debts and liabilities, the names, residences and occupations of its creditors, the securities held by them respectively, the dates when the securities were respectively given and such further or other information as may be prescribed.

(2) The statement shall be submitted by, and be verified by affidavit of, one or more of the persons who are at the date of the receiver’s appointment the directors and by the person who is at that date the secretary of the company, or by such of the persons hereafter in this subsection mentioned as the receiver (or his successor), subject to the direction of the Court, may require to submit and verify the statement, that is to say, persons—

(a) who are or have been officers of the company;

(b) who have taken part in the formation of the company at any time within one year before the date of the receiver’s appointment;

(c) who are in the employment of the company, or have been in the employment of the company within that year, and are in the opinion of the receiver capable of giving the information required;

Special provisions as to statement submitted to receiver.

[No. ] The Companies Act, 2004248

(d) who are or have been within that year officers of or in the employment of a company which is, or within that year was, an officer of the company to which the statement relates.

(3) Any person making the statement and affidavit shall be allowed, and shall be paid by the receiver (or his successor) out of his receipts, such costs and expenses incurred in and about the preparation and making of the statement and affidavit as the receiver (or his successor) may consider reasonable, subject to an appeal to the Court.

(4) Where the receiver is appointed under the powers contained in any instrument, this section shall have effect with the substitution for references to the Court of references to the Registrar and for references to an affidavit of references to a statutorydeclaration.

(5) If any person without reasonable excuse makes default in complying with the requirements of this section, he shall be liable to a fine not exceeding three thousand dollars for every day during which the default continues.

(6) References in this section to the receiver’s successor shall include a continuing receiver or manager.

347.—(1) Except where subsection (2) of section 345 applies, every receiver or manager of the property of a company who has been appointed under the powers contained in any instrument shall, within one month, or such longer period as the Registrar may allow, after the expiration of the period of six months from the date of his appointment and of every subsequent period of six months, and within one month after he ceases to act as receiver or manager, deliver to the Registrar for registration an abstract in the prescribed form showing his receipts and his payments during that period of six months, or, where he ceases to act as aforesaid, during the period from the end of the period to which the last preceding abstract related up to the date of his so ceasing, and the aggregate amount of his receipts and of his payments during all preceding periods since his appointment.

(2) Every receiver or manager who makes default in complying with the provisions of this section shall be liable to a fine not

Delivery to Registrar of accounts of receivers and managers.

249The Companies Act, 2004 [No. ]

exceeding two thousand dollars for every day during which the default continues.

348.—(1) Ifanyreceiverormanagerof thepropertyofa company—

(a) havingmadedefault infiling,deliveringormakinganyreturn, account or other document, or in giving any notice, which a receiver or manager is by law required to file, deliver, make or give, fails to make good the default within fourteen days after the service on him of a notice requiring him to do so; or

(b) having been appointed under the powers contained in any instrument, has, after being required at any time by the liquidator of the company so to do, failed to render proper accounts of his receipts and payments and to vouch the same and to pay over to the liquidator the amount payable to him,

the Court may, on an application made for the purpose, make an order directing the receiver or manager, as the case may be, to make good the default within such time as may be specified in the order.

(2) In the case of any such default as is mentioned in paragraph (a) of subsection (1) an application for the purposes of this section may be made by any member or creditor of the company or by the Registrar, and in the case of any such default as is mentioned in paragraph (b) of that subsection the application shall be made by the liquidator, and in either case the order may provide that all costs of and incidental to the application shall be borne by the receiver or manager, as the case may be.

(3) Nothing in this section shall be taken to prejudice the operationofanyenactments imposingpenaltiesonreceiversormanagers in respect of any such default as is mentioned in subsection (1).

349.—(1) A receiver or manager of the property of a company appointed under the powers contained in any instrument shall, to the sameextentas ifhehadbeenappointedbyorderofacourt,bepersonally liable on any contract entered into by him in the performance of his functions,except insofaras thecontractotherwiseprovides,andentitled in respect of that liability to indemnity out of the assets; but nothing in

Enforcement of duty of receivers and managers to make returns, etc.

Liability of receiver for contracts, etc.

[No. ] The Companies Act, 2004250

this subsectionshallbe takenas limitinganyright to indemnitywhichhe would have apart from this subsection, or as limiting his liability on contracts entered into without authority or as conferring any right to indemnity in respect of that liability.

(2) This section shall apply whether the receiver or manager was appointed before or after the appointed day but subsection (1) shall not apply to contracts entered into before that day.

350. It is hereby declared that, except where the context otherwise requires—

(a) any reference in this Act to a receiver or manager of the property of a company, or to a receiver thereof, includes a reference to a receiver or manager, or (as the case may be) to a receiver, of part only of the property and to a receiver only of the income arising from that property or from part thereof; and

(b) any reference in thisAct to the appointment of a receiver or manager under powers contained in any instrument includes a reference to an appointment made under powers which, by virtue of any enactment, are implied in and have effect as if contained in an instrument.

PART VII—REGISTRATIONOFFICEAND FEES

351.—(1) For the purposes of thisAct there shall be a Registrar of Companies whose office shall be a public office, and the Minister shall establish in the Island a registration office of companies.

(2) The Registrar may in writing authorize any officer of his department to execute, subject to the Registrar’s directions and to prescribe conditions (if any), functions assigned to the Registrar by any enactment.

(3) Anything executed by any officer to whom authority is given under this section and in accordance with such authority shall be as valid and effectual as if it were executed by the Registrar.

(4) Notice of any authority given under this section and of any extension or revocation of such authority shall be published in the

Construction of references to receivers and managers.

Registrar of Companies and registration office.

251The Companies Act, 2004 [No. ]

Gazette but failure to publish such notice shall not affect the validity of the authority conferred, or any extension or revocation thereof, as the case may be.

352.—(1) Any person may inspect the documents kept by the Registraronpaymentof theprescribed fees, andanypersonmayrequire a certificate of the incorporation of any company, or a copy or extract of any other document or any part of any other document, to be certified by the Registrar, on payment of the prescribed fees.

(2) No process for compelling the production of any document kept by the Registrar shall issue from any Court except with the leave of that Court, and any such process if issued shall bear thereon a statement that it is issued with the leave of the Court.

(3) A copy of or extract from any document kept and registered at the office for the registration of companies, certified to be a true copy under the hand of the Registrar (whose official position it shall not be necessary to prove), shall in all legal proceedings be admissible in evidence as of equal validity with the original document.

(4) The Minister may make rules subject to affirmative resolution, prescribing the maximum period for which the Registrar is required to retainanydocumentsorcategory thereofkept and registered at the office.

353.—(1) If a company, having made default in complying with any provision of thisAct which requires it to file with, or deliver or send to, the Registrar any return, account or other document, or to give notice to him of any matter, fails to make good the default within fourteen days after the service of a notice on the company requiring it to do so, a Judge in Chambers may, on an application made to him by any member or creditor of the company or by the Registrar, make an order directing the company and any officer thereof to make good the default within such time as may be specified in the order:

Provided that the Judge may refer the application for hearing in open Court.

(2) Anysuchordermayprovidethatallcostsofandincidental to the application shall be borne by the company or by any officers of the company responsible for the default.

Inspection, production, evidence and retention of documents kept by Registrar.

Enforcement of duty of company to make returns to Registrar.

[No. ] The Companies Act, 2004252

(3) Nothing in this section shall be taken to prejudice the operation of any enactment imposing penalties on a company or its officers in respect of any such default as aforesaid.

PART VIII—APPLICATION OFACTTO EXISTING COMPANIES

354. In the application of thisAct to existing companies it shall apply in the same manner—

(a) in thecaseofa limitedcompany,other thanacompanylimited by guarantee, as if the company had been formed and registered under thisAct as a company limited by shares;

(b) in the case of a company limited by guarantee, as if the company had been formed and registered under thisAct as a company limited by guarantee; and

(c) in the case of a company other than a limited company, as if the company had been formed and registered under thisAct asanunlimitedcompany:

Provided that reference, express or implied, to the date of registration or recording shall be construed as a reference to the date at which the company was registered or recorded before the commencement of this Act.

PART IX—WINDING UPOFUNREGISTERED COMPANIES

355. For the purposes of this Part, the expression “unregistered company” shall not include a friendly society registered and established under the Friendly Societies Act, or a society established under the BuildingSocietiesAct,but shall includeanypartnershipwhether limited or not, association or company not registered under the law relating to companies before the commencement of thisAct or under thisAct, so, however, that any such partnership, association or company which is not a foreign partnership, association or company shall consist of not less than eight members, and all the provisions of thisAct with respect towindingupshallapplytosuchacompany,withthefollowingexceptions and additions, that is to say—

(a) no unregistered company shall be wound up under thisAct voluntarily or subject to supervision;

Application of Act to existing companies.

Meaning and winding up of unregistered company.

253The Companies Act, 2004 [No. ]

(b) the circumstances in which an unregistered company may be wound up are as follows, that is to say—

(i) if the company is dissolved, or has ceased to carry on business, or is carrying on business only for the purpose of winding up its affairs;

(ii) if the company is unable to pay its debts;

(iii) if theCourt isofopinion that it is justandequitable that the company should be wound up;

(c) an unregistered company shall, for the purposes of thisAct, be deemed to be unable to pay its debts—

(i) if acreditor, byassignmentorotherwise, towhom the company is indebted in a sum exceeding two hundred thousand dollars then due, has served on the company, by leaving at its principal place of business, or by delivering to the secretary or some director, manager or principal officer of the company, or by otherwise serving in such manner as the Court may approve or direct, a demand under his hand requiring the company to pay the sumso due, and thecompanyhas, for threeweeks after the service of the demand, neglected to pay the sum or to secure or compound for it to the satisfaction of the creditor;

(ii) if any action or other proceeding has been instituted against any member for any debt or demand due or claimed to be due from the company,or fromhiminhischaracterofmember, andnotice inwritingof the institutionof theaction orproceedinghavingbeenservedonthecompany by leaving the same at its principal place of business, or by delivering it to the secretary or some director, manager, or principal officer of the company,orbyotherwiseservingthesameinsuch manner as the Court may approve or direct, the

[No. ] The Companies Act, 2004254

company has not, within ten days after service of the notice, paid, secured, or compounded for the debt or demand, or procured the action or proceeding to be stayed, or indemnified the defendant to his reasonable satisfaction against the action or proceeding, and against all costs, damages, and expenses to be incurred by him by reason of the same;

(iii) if execution or other process issued on a judgment, decree, or order obtained in the Court in favour of a creditor against the company, or any member thereof as such, or any person authorized to be sued as nominal defendant on behalf of the company, is returned unsatisfied;

(iv) if it is otherwise proved to the satisfaction of the Court that the company is unable to pay its debts.

356.—(1) In the event of an unregistered company being wound up, every person shall be deemed to be a contributory who is liable to pay or contribute to the payment of any debt or liability of the company, or to pay or contribute to the payment of any sum for the adjustment of the rights of the members among themselves, or to pay or contribute to the payment of the costs and expenses of winding up the company, and every contributory shall be liable to contribute to the assets of the company all sums due from him in respect of any such liability as aforesaid.

(2) In the event of the death or bankruptcy of any contributory, the provisions of this Act with respect to the personal representatives of deceased contributories, and to the trustees of bankrupt contributories, shall apply.

357.The provisions of thisAct with respect to staying and restraining actions and proceedings against a company at any time after the presentation of a petition for winding up and before the making of a winding up order, shall, in the case of an unregistered company, where the application to stay or restrain is by a creditor, extend to actions and proceedings against any contributory of the company.

Contributories in winding up of unregistered company.

Power of Court to stay or restrain proceedings.

255The Companies Act, 2004 [No. ]

358. Where an order has been made for winding up an unregistered company, no action or proceeding shall be proceeded with or commenced against any contributory of the company in respect of any debt of the company, except by leave of the Court, and subject to such terms as the Court may impose.

359. Where a company incorporated outside the Island which has been carrying on business in the Island ceases to carry on business in the Island, it may be wound up as an unregistered company under this Part, notwithstanding that it has been dissolved or otherwise ceased to exist as a company under or by virtue of the laws of the country under which it was incorporated.

360.Theprovisionsof thisPartwithrespect tounregisteredcompanies shallbe inaddition toandnot inrestrictionofanyprovisionshereinbefore in thisActcontainedwith respect towindingupcompaniesby theCourt, and the Court or liquidator may exercise any powers or do any act in the case of unregistered companies which might be exercised or done by it or him in winding up companies formed and registered under this Act; but an unregistered company shall not, except in the event of its being wound up, be deemed to be a company under thisAct, and then only to the extent provided by this Part.

361. In the case of a limited partnership the provisions of this Act with respect towindingupshall applywithsuchmodifications, if any,as may from time to time be prescribed by the Minister and with the substitution of general partners for directors.

PART X—COMPANIESINCORPORATEDOUTSIDE THE ISLAND CARRYING ON BUSINESS WITHIN THE ISLAND

362. This Part shall apply to all companies incorporated outside the Island which, after the appointed day, establish a place of business within the Island, and to all companies incorporated outside the Island which have, before the appointed day, established a place of business within the Island and continue to have an established place of business within the Island after the appointed day.

Action stayed on winding up order.

Winding up company incorporated outside Island.

Provisions of Part IX cummulative.

Winding up of limited partnership.

Companies to which Part X applies.

[No. ] The Companies Act, 2004256

363.—(1) Companies incorporated outside the Island which after the appointed day establish a place of business within the Island, shall within one month (or, in the case of any of the documents mentioned in paragraph (a) of this subsection or such longer period not exceeding four months as the Minister may allow) from the establishment of the place of business, deliver to the Registrar for registration—

(a) a certified copy of the charter, statutes or articles of the company, or other instrument constituting or defining the constitution and containing the name of the company, and, if theinstrumentisnotwrittenintheEnglishlanguage,acertified translation thereof;

(b) a list of the directors of the company, containing such particulars with respect to the directors as are by this Act required to be contained with respect to directors in the register of the directors of a company;

(c) the names and addresses of some one or more persons resident in the Island authorized to accept on behalf of the company service of process and any notices required to be served on the company.

(2) The provisions of subsection (1) shall apply in relation tocompanies towhich thisPartapplies,other thancompaniesmentioned in that subsection, as they apply in relation to companies so mentioned with the substitution for the words “one month” of the words “three months”, for the words “four months” of the words “six months”, and for the words “the establishment of the place of business” of the words “the appointed day”.

(3) If within six months of the delivery to the Registrar pursuant to subsection (1) by any such company as is mentioned in that subsection of the instrument containing the name of the company it appears to the Registrar that such name too closely resembles the name registered in respectofanyothercompany(whether incorporatedwithin or outside Jamaica) in the documents registered at the office for the registrationofcompanies, theRegistrarmaydirect such first-mentioned company within six weeks of the date of the direction (or within such

Documents, etc. to be delivered to Registrar by companies carrying on business in the Island.

257The Companies Act, 2004 [No. ]

longer period as the Registrar may think fit to allow) in addition to or in place of its principal name to take an alternative name approved by the Registrar as the name in which it proposes to carry on business in Jamaica.

(4) Where a direction has been given to a company pursuant to subsection (3) the company shall—

(a) on or before the expiration of the time given by the Registrar notify inwriting to theRegistrar for thepurposeofregistration by him the approved alternative name taken by the company pursuant to the direction; and

(b) after thedateofsuchnotificationcarryonbusiness inJamaica solely in that alternative name.

364. Acompany incorporated outside the Island shall have the same power to hold lands in the Island as if it were a company incorporated under thisAct.

365.—(1) If in the case of any company to which this Part applies any alteration is made in—

(a) the charter, statutes, or articles of the company or any such instrument as aforesaid; or

(b) the directors of the company or the particulars contained in list of the directors; or

(c) the names or addresses of the persons authorized to accept service on behalf of the company,

the company shall, within twenty-one days after the date on which particulars of the alterations could, in due course of post and if despatched with due diligence, have been received in the Island from the place where the company is incorporated, deliver to the Registrar for registration a return containing the prescribed particulars of the alteration.

(2) Where an alteration made to the name of any company to which this Part applies is shown in a return delivered to the Registrar for registration pursuant to subsection (1), the provisions of subsections (3) and (4) of section 363 shall apply with the necessary modifications

Power of companies incorporated outside Island to hold lands.

Return to be delivered to Registrar where documents, etc. altered.

[No. ] The Companies Act, 2004258

in relation to thenameof thecompanyasalteredas theyapply in relation to thenameofacompanycontained in the relevant instrumentdelivered to the Registrar pursuant to paragraph (a) of subsection (1) of that section.

366.—(1) Subject to the provisions of this section, every company towhich thisPart applies shall ineverycalendaryearmakeoutabalance sheet and profit and loss account and, if the company is a holding company, group accounts in such form, and containing such particulars and including such documents, as under the provisions of thisAct it would, if it had been a company incorporated under this Act, have been required to make out and lay before the company in general meeting, and deliver a copy of those documents to the Registrar for registration.

(2) Subject to the provisions of this section, a company to which this Part applies may in any calendar year, at the option of the company, in lieu of complying with the requirements of subsection (1) in relation to that year, deliver to the Registrar for registration a copy of its balance sheet and profit and loss account or, if the company is a subsidiary company, a copy of the balance sheet of its holding com- pany, prepared in the form required under the law of the place of the company’s incorporation,but in theeventof exercising theoptiongiven by this subsection the company shall also deliver to the Registrar for registration—

(a) a profit and loss account, prepared in the English language and to the satisfaction of the Registrar made out as nearly as may be in the form and containing the particulars required by this Act in relation to the profit and loss account of a company incorporated under this Act, on the company’s operations in Jamaica as if such operations had been conducted by a separate company incorporated under this Act, so, however, that the company shall be entitled to make such apportionments and to add such notes and explanations as shall in its opinion be necessary or desirable to give a true and fairview of the profit or loss on its operations in Jamaica and for this purpose may debit a reasonable rate of interest on capital employed in Jamaica;

Accounts of company carrying on business in Island.

259The Companies Act, 2004 [No. ]

(b) a statement as at the date to which the company’s profit and loss account is made up prepared in the English language andshowing thecompany’sassets locallysituated inJamaica classified, distinguished and valued in accordance with the provisionsof thisActaffecting theclassifying,distinguishing and valuing of the assets of a company incorporated under thisAct and the nature and amount of any specific charges on such assets;

(c) a report prepared in the English language on the account and statement referred to in paragraphs (a) and (b) by an accountantqualifiedunder thisAct forappointmentasauditor of a company which is not a private company or of a private company which is obliged to file accounts stating that in his opinion and to the best of his information such account and statement are in accordance with the books and records of the company and give the information required by thisAct in the manner therein required and give a true and fair view of the matters therein stated.

(3) Subject to subsection (5), if any document mentioned in subsection (1), or if any document mentioned in subsection (2) which is not required by subsection (2) to be in the English language, is not in the English language, there shall be annexed thereto a certified translation thereof.

(4) In relation to the balance sheets, accounts and statements referred to in this section the Minister shall have the same powers to modify any of the requirements imposed by virtue of this section as he has to modify the requirements imposed by thisAct in relation to the balance sheets and profit and loss accounts of a company incorporated under thisAct.

(5) The Minister, if, having regard to the nature and volume of the business done in the Island by the company or class of companies affected, he is satisfied that it is expedient so to do, may by order grant, to such extent and subject to such conditions as may be specified in the order, exemption—

(a) to any holding company, or class of holding companies, to which this Part applies, from the provisions of

[No. ] The Companies Act, 2004260

subsection (1) requiring the making out of group accounts, and the delivery to the Registrar of a copy of any documents relating to such accounts; and

(b) to any company, or class of companies, to which this Part applies, from the provisions of subsection (3) requiring the annexing of a certified translation to any document.

367.—(1) Every company to which this Part applies shall—

(a) in every prospectus inviting subscriptions for its shares or debentures in the Island state the country in which the company is incorporated; and

(b) conspicuously exhibit on every place where it carries on business in the Island the name of the company and the country in which the company is incorporated; and

(c) cause the name of the company and of the country in which thecompany is incorporated tobestated in legible characters in all bill-heads and letter paper, and in all notices and other official publications of the company; and

(d) if the liabilityof themembersof thecompanyis limited,cause notice of that fact to be stated in legible characters in every suchprospectusasaforesaidand inallbill-heads, letterpaper, notices and other official publications of the company in the Island, and to be affixed on every place where it carries on its business.

(2) In their application to any company in respect of which there has been registered an alternative name pursuant to the provisions of subsections (3) and (4) of section 363 or by virtue of the provisions of subsection (2) of section 365, the provisions of paragraphs (b) and (c) of subsection (1) of this section requiring the exhibiting and stating of the name of the company shall be taken to require the exhibiting and stating of the alternative name as well as the principal name of the company on the places and in the documents specified in those paragraphs in the manner respectively so specified.

Obligation to state name of company, whether limited and country where incorporated.

261The Companies Act, 2004 [No. ]

368. Any process or notice required to be served on a company to which this Part applies shall be sufficiently served if addressed to any person whose name has been delivered to the Registrar under this Part and left at or sent by post to the address which has been so delivered:

Provided that—

(a) where any such company makes default in delivering to the Registrar the name and address of a person resident in the Island who is authorized to accept on behalf of the company service of process or notices; or

(b) if at any time all the persons whose names and addresses have been so delivered are dead or have ceased so to reside, or refuse to accept service on behalf of the company, or for any reason cannot be served,

a document may be served on the company by leaving it at or sending it by post to any place of business established by the company in the Island.

369. If any company to which this Part applies ceases to have a place of business in the Island it shall forthwith give notice of the fact to the Registrar, and as from the date on which notice is so given the obligation of the company to deliver any document to the Registrar under thisAct shall cease:

Provided that in case the Registrar is satisfied by any other means that the company has ceased to have a place of business in the Island it shall be lawful for him to close the file of the company unless it is necessary to maintain the file for the purposes of the Transfer TaxAct, and upon such closure the obligation of the company to deliver any document to the Registrar under thisAct shall cease.

370. If any company to which this Part applies fails to comply with any of the foregoing provisions of this Part the company, and every officeroragentof thecompanywhoknowinglyorwilfullyauthorizesor permits the default shall be liable to a fine not exceeding fifty thousand dollars, or, in the case of a continuing offence, two thousand dollars for every day during which the default continues.

Service on company to which Part X applies.

Removing company's name from register.

Penalties.

[No. ] The Companies Act, 2004262

371. For the purposes of this Part—

“certified” means certified in the manner prescribed to be a true copy or a correct translation;

“director” in relation to a company includes any person in accordancewithwhosedirectionsor instructions thedirectors of the company are accustomed to act;

“place of business” includes a share transfer or share registration office;

“principalname”means—

(a) in relation to a company to which a direction has been given pursuant to subsection (3) of section 363, the name of the company contained in the relevant instrument delivered to the Registrar pursuant to paragraph (a) of subsection (1) of that section; and

(b) in relation to a company to which a direction has been given by virtue of the provisions of subsection (2) of section 365, the altered name of the company as shown in the return delivered to the Registrar pursuant to subsection (1) of that section;

“prospectus” has the same meaning as when used in relation to a company incorporated under thisAct.

PART XI—RESTRICTIONS ON SALE OF SHARES AND OFFERS OF SHARES FOR SALE

372.—(1) The provisions of subsections (2) to (6) of this section shall have effect in relation to the issuing, circulating or distributing in the Island by any person of any prospectus offering for subscription shares in or debentures of a company incorporated or to be incorporated outside the Island, whether the company has or has not established, or when formed will or will not establish, a place of business in the Island.

(2) Every such prospectus shall be dated.

Provisions with respect to prospectuses of foreign companies inviting subscriptions for shares or offering shares for sale.

Interpretation of Part X.

263The Companies Act, 2004 [No. ]

(3) No such prospectus shall be issued, circulated or distributed in the Island unless before the date of such issue, circulation or distribution—

(a) there has been delivered to the Registrar for the purpose of securing registration of the prospectus a copy thereof certified by the chairman and two other directors of the company as having been approved by resolution of the managing body; and

(b) pursuant thereto registration has been effected.

(4) Every such prospectus shall state on the face of it that the prospectus has been registered as required by this subsection.

(5) The Registrar shall not register any such prospectus unless it is dated, and the copy thereof certified, in manner required by this section and there is endorsed on or attached to the copy—

(a) any consent to the issue of the prospectus required by section 3 74;

(b) a copy of any contract required by paragraph 11 of the Third Schedule to be stated in the prospectus or, in the case of a contract not reduced into writing, a memorandum giving fullparticulars thereof; and

(c) where the persons making any report required by Part II of that Schedule have made therein or have, without giving the reasons, indicated therein any such adjustments as are mentioned in paragraph 21 of that Schedule, a written statement signedby thosepersonssettingout theadjustments and giving the reasons therefor.

(6) The reference in paragraph (b) of subsection (5) to the copy of a contract required thereby to be endorsed on or attached to a copy of the prospectus shall, in the case of a contract wholly or partly in a foreign language, be taken as a reference to a copy of a translation of the contract in English or a copy embodying a translation in English of the parts in a foreign language, as the case may be, being a translation certified in the prescribed manner to be a correct translation.

Third Schedule.

[No. ] The Companies Act, 2004264

(7) The provisions of subsection (4) of section 40 which relate to the power of the Registrar to refuse to register prospectuses and the provisions of subsection (5) of that section shall, with the necessary modifications, apply in relation to prospectuses referred to in subsection (1) of this section as they apply in relation to prospectuses referred to in that section.

(8) Whenever the Registrar has registered a prospectus under this section he shall in writing inform the company or any other person who has delivered the copy of the prospectus pursuant to this section, of the fact of registration and the date thereof, and every prospectus referred to in subsection (1) issued, circulated or distributed in the Island by any person shall show on its face, in addition to the date required by subsection (2), the date of registration.

(9) It shall not be lawful for any person to issue to any person in the Island a form of application for shares in or debentures of such a company or intended company as is mentioned in subsection (1) unless the form is issued with a prospectus which complies with this Part and the issue whereof does not contravene the provisions of section 374:

Provided that this subsection shall not apply if it is shown that the form of application was issued in connection with a bona fide invitation to a person to enter into an underwriting agreement with respect to the shares or debentures.

(10) This section shall not apply to the issue to existing members or debenture holders of a company of a prospectus or form ofapplicationrelating toshares inordebenturesof thecompany,whether an applicant for shares or debentures will or will not have the right to renounce in favourofotherpersons,but, subjectasaforesaid, this section shall apply to a prospectus or form of application whether issued on or with reference to the formation of a company or subsequently.

373.—(1) Any such prospectus as is mentioned in subsection (1) of section 372 shall also—

(a) contain particulars with respect to the following matters—

(i) any restrictions on the business that the company can conduct;

Additional requirements as to prospectus.

265The Companies Act, 2004 [No. ]

(ii) the instrument constituting or defining the constitution of the company;

(iii) the enactments, or provisions having the force of anenactment,byorunderwhich the incorporation of the company was effected;

(iv) an address in the Island where those instruments, enactments or provisions, or copies thereof, and if, the same are in a foreign language a translation thereof certified in the prescribed manner, can be inspected;

(v) the date on which and the country in which the company was incorporated;

(vi) whether the company has established a place of business in the Island, and, if so, the address of its office in the Island:

Provided that the provisions of sub-paragraphs (i), (ii), (iii) and (iv) shall not apply in the case of a prospectus issued more than two years after the date at which the company is entitled to commence business;

(b) subject to the provisions of this section, state the matters specified in Part I of the Third Schedule and set out the reports specified in Part II of that Schedule:

Providedthat inparagraph1of theThirdScheduleareference to the constitution of the company shall be substituted for the reference to the articles.

(2) Any condition requiring or binding any applicant for shares or debentures to waive compliance with any requirement of this section,orpurportingtoaffecthimwithnoticeofanycontract,document, or matter not specifically referred to in the prospectus, shall be void.

(3) In the event of non-compliance with or contravention of any of the requirements of this section, a director or other person responsible for the prospectus shall not incur any liability by reason of the non-compliance or contravention, if—

(a) as regards any matter not disclosed, he proves that he was not cognizant thereof; or

Third Schedule.

[No. ] The Companies Act, 2004266

(b) he proves that the non-compliance or contravention arose from an honest mistake of fact on his part; or

(c) thenon-complianceorcontraventionwasinrespectofmatters which, in the opinion of the Court dealing with the case, were immaterial or were otherwise such as ought, in the opinion of that Court, having regard to all the circumstances of the case, reasonably to be excused:

Provided that—

(a) where any prospectus is published as a newspaper advertisement, it shall be a sufficient compliance with the requirement that the prospectus must specify the objects of the company if the advertisement specifies theprimaryobjectwithwhichthecompanywasformed; and

(b) in paragraph 2 of the Third Schedule a reference to the constitution of the company shall be substituted for the reference to the articles.

(4) This section shall not apply to the issue to existing members or debenture holders of a company of a prospectus or form ofapplicationrelating toshares inordebenturesof thecompany,whether an applicant for shares or debentures will or will not have the right to renounce in favourofotherpersons,but, subject asaforesaid, this section shall apply to a prospectus or form of application whether issued on or with reference to the formation of a company or subsequently.

(5) Nothinginthissectionorsection372shall limitordiminish any liability which any person may incur under the general law or this Act, apart from those sections.

374.—(1) It shall not be lawful for any person to issue, circulate or distribute in the Island any prospectus offering for subscription shares in or debentures of a company incorporated or to be incorporated outside the Island, whether the company has or has not established, or whenformedwillorwillnotestablish,aplaceofbusiness in theIsland—

(a) if, where the prospectus includes a statement purporting to bemadebyanexpert, hehasnotgiven,orhasbeforedelivery

Third Schedule.

Provisions as to expert's consent and allotment.

267The Companies Act, 2004 [No. ]

of the prospectus for registration withdrawn, his written consent to the issue of the prospectus with the statement included in the form and context in which it is included or there does not appear in the prospectus a statement that he has given and has not withdrawn his consent as aforesaid; or

(b) if the prospectus does not have the effect, where an application is made in pursuance thereof, of rendering all persons concerned bound by all the provisions (other than penal provisions) of section 51 as far as applicable.

(2) In this section the expression “expert” includes engineer, valuer, accountant and any other person whose profession gives authority to a statement made by him, and for the purposes of this section a statement shall be deemed to be included in a prospectus if it is contained therein or in any report or memorandum appearing on the face thereof or by reference incorporated therein or issued therewith.

375. Any person who is knowingly responsible for the issue, circulation or distribution of a prospectus, or for the issue of a form of application for shares or debentures, in contravention of any of the provisions of sections 372, 373 and 374 shall be liable to a fine not exceeding fifty thousand dollars.

376. Section 44 shall extend to every prospectus offering for subscription shares in or debentures of a company incorporated or to be incorporated outside the Island, whether the company has or has not established, or when formed will or will not establish, a place of business in the Island, with the substitution, for references to section 42 of references to section 374.

377.—(1)Whereanydocumentbywhichanyshares inordebentures of a company incorporated outside the Island are offered for sale to the public would, if the company concerned had been a company within the meaning of thisAct, have been deemed by virtue of section 46 to be a prospectus issued by the company, that shall be deemed to be, for the purposes of this Part, a prospectus issued by the company.

(2) An offer of shares or debentures for subscription or sale to any person whose ordinary business is to buy or sell shares or debentures, whether as principal or agent, shall not be deemed an offer to the public for the purposes of this Part.

(3) In this Part the expressions “prospectus”, “shares” and “debentures” have the same meanings as when used in relation to a company incorporated under thisAct.

Penalty for contravention of sections 372, 373 and 374.

Civil liability for misstatements in prospectus.

Interpretation of provisions as to prospectuses.

[No. ] The Companies Act, 2004268

PART XII—MISCELLANEOUS

Prohibition of Partnerships with more than Twenty Members

378.(1) No company, association, or partnership consisting of more than twenty persons shall be formed for the purpose of carrying on any business (other than the business of banking) for the acquisition of gain by the company, association, or partnership, or by the individual members thereof, unless it is registered as a company under thisAct, or is formed in pursuance of some other local statute, or of letters patent.

(2) Nothing in subsection (1) prohibits the formation—

(a) for the purpose of carrying on practice as attorneys-at-law, of a partnership consisting of persons each of whom is an attorney-at-law;

(b) for the purpose of carrying on practice as accountants, of a partnership consisting of persons each of whom is registered as a public accountant under the PublicAccountancyAct;

(c) of a partnership consisting of persons each of whom is a member of such profession as may be prescribed in regulations made under thisAct for the purpose.

Provisions relating to Banks

379. No company, association, or partnership consisting of more than ten persons shall be formed for the purpose of carrying on the business of banking, unless it is registered as a company under thisAct, or is formed in pursuance of some other local statute, or of letters patent.

Application of certain Provisions of this Act to Unregistered Companies

380.(1) The provisions of thisAct specified in the second column of the Eleventh Schedule (which respectively relate to the matters referred to in the first column of that Schedule) shall apply to all bodies corporate incorporated in and having a principal place of business in the Island, other than those mentioned in subsection (2), as if they were companies registered under this Act, but subject to any limitations mentioned inrelation to thoseprovisions respectively in the thirdcolumn of that Schedule and to such adaptations and modifications (if any) as may be specified by regulations made by the Minister.

Prohibition of partnerships with more than twenty members.

Prohibition of banking partnerships with more than ten members.

Application of certain provisions of this Act to unregistered companies. Eleventh Schedule.

269The Companies Act, 2004 [No. ]

(2) The provisions of that Schedule shall not apply by virtue of this section to any of the following, that is to say—

(a) any body incorporated by or registered under any local statute; and

(b) any body not formed for the purpose of carrying on a business which has for its object the acquisition of gain by the body or by the individual members thereof; and

(c) any body for the time being exempted by direction of the Minister.

(3) This section shall not repeal or revoke in whole or in part any enactment, royal charter or other instrument constituting or regulating any body in relation to which those provisions are applied by virtue of this section, or restrict the power of Her Majesty to grant a charter in lieu of or supplementary to any such charter as aforesaid; but, in relation to any such body, the operation of any such enactment, charter or instrument shall be suspended in so far as it is inconsistent with any of those provisions as they apply for the time being to that body.

(4) Any regulations made under this section or the Eleventh Schedule shall be subject to negative resolution.

Form of Registers, etc.

381.—(1) Any register, index, minute book or book of account required by this Act to be kept by a company may be kept either by making entries in bound books or by recording the matters in question in any other manner.

(2) Where any such register, index, minute book or book of account is not kept by making entries in a bound book, but by some other means, adequate precautions shall be taken for guarding against falsification and facilitating its discovery, and where default is made in complying with this subsection the company and every officer of the company who is in default shall be liable to a fine not exceeding fifty thousand dollars.

Eleventh Schedule.

Forms of registers, etc.

[No. ] The Companies Act, 2004270

Miscellaneous Offences

382. If any person in any return, report, certificate, balance sheet, or other document, required by or for the purposes of any of the provisions of thisAct specified in the Ninth Schedule, wilfully makes a statement which is false in any material particular, knowing it to be false, he shall be guilty of a misdemeanour, and shall be liable on conviction on indictment to imprisonment with or without hard labour for a term not exceeding two years and be liable on summary conviction before a Resident Magistrate to imprisonment with or without hard labour for a term not exceeding four months, and in either case to a fine in lieu of or in addition to such imprisonment as aforesaid:

Provided that—

(a) the fine imposed on summary conviction shall not exceed fifty thousanddollars;

(b) nothinginthissectionshallaffect theprovisionsof thePerjury Act.

383. If any person or persons trade or carry on business under any name or title of which “Limited”, or any contraction or imitation of that word, is the last word, that person or those persons shall, unless duly incorporated with limited liability, be liable to a fine not exceeding five hundred dollars for every day upon which that name or title has been used.

Provisions us to Offences

384.—(1) Where by any enactment in thisAct it is provided that a company and every officer of the company who is in default shall be liable to a fine, the company and every such officer shall, for every day during which the default, refusal or contravention continues, be liable to a fine not exceeding such amount as is specified in that enactment, or if the amount of the fine is not so specified, to a fine not exceeding fifty thousand dollars.

(2) For the purpose of any enactment in this Act which provides that an officer of a company who is in default shall be liable to a fine or penalty, the expression “officer who is in default” means any director, manager, secretary or other officer of the company, who knowingly and wilfully authorizes or permits the default, refusal or contravention mentioned in the enactment.

Penalty for improper use of word "Limited".

Penalty for false statement. Ninth Schedule.

Provision with respect to default fines and meaning of "officer in default".

271The Companies Act, 2004 [No. ]

385. All offences under this Act made punishable by fine may be prosecuted in the Resident Magistrate’s Court in a summary manner; and any person upon whom a fine is imposed in respect of any such offence shall in default of payment thereof be liable to imprisonment with or without hard labour for a term not exceeding twelve months.

386.—(1) If on an application made to a Judge in Chambers by the Director of Public Prosecution or the Minister there is shown to be reasonable cause to believe that any person has, while an officer of a company, committed an offence in connection with the management of thecompany’saffairsandthatevidenceof thecommissionof theoffence is to be found in any books or papers of or under the control of the company, an order may be made—

(a) authorizing any person named therein to inspect the said books or papers or any of them for the purpose of investigating and obtaining evidence of the offence; or

(b) requiring the secretary of the company or such other officer thereof as may be named in the order to produce those books or papers or any of them to a person named in the order at a place so named.

(2) Subsection (1) shall apply also in relation to any books or papers of a person carrying on the business of banking so far as they relate to the company’s affairs, as it applies to any books or papers of or under the control of the company, except that no such order as is referred to in paragraph (b) thereof shall be made by virtue of this subsection.

(3) The decision of a Judge on an application under this section shall not be appealable.

Service of Documents and Legal Proceedings

387. Adocument may be served on a company by leaving it at or sending it by post to the registered office of the company.

388. Where a limited company is plaintiff in any action or other legal proceeding,any judgehaving jurisdiction in themattermay, if it appears by credible testimony that there is reason to believe that the company

Prosecution of offences punishable by fine.

Production and inspection of books where offence suspected.

Service of documents on company.

Costs in actions by certain limited companies.

[No. ] The Companies Act, 2004272

will be unable to pay the costs of the defendant if successful in his defence, require sufficient security to be given for those costs, and may stay all proceedings until the security is given.

389.—(1) If in any proceeding for negligence, default, breach of duty, or breach of trust against a person to whom this section applies it appears to the Court hearing the case that the person is or may be liable in respect of the negligence, default, breach of duty or breach of trust, but that he has acted honestly and reasonably, and that, having regard to all the circumstances of the case, including those connected with his appointment, he ought fairly to be excused for the negligence, default, breach of duty or breach of trust, that Court may relieve him. either wholly or partly, from his liability on such terms as the Court may thinkfit.

(2) Where any person to whom this section applies has reason to apprehend that any claim will or might be made against him in respect of any negligence, default, breach of duty or breach of trust, he may apply to the Court for relief, and the Court on any such application shall have the same power to relieve him as under this section it would have had if it had been a court before which proceedings against that person for negligence, default, breach of duty or breach of trust had been brought.

(3) Where any case to which subsection (1) applies is being tried by a judge with a jury, the judge, after hearing the evidence, may, if he is satisfied that the defendant ought in pursuance of that subsection to be relieved either in whole or in part from the liability sought to be enforced against him, withdraw the case in whole or in part from the jury and forthwith direct judgment to be entered for the defendant on such terms as to costs or otherwise as the judge may think proper.

(4) The persons to whom this section applies are the following—

(a) directors of a company;

(b) officers of a company;

(c) persons employed by a company as auditors whether they are or are not officers of the company.

Power of Court to grant relief in certain cases.

273The Companies Act, 2004 [No. ]

390. Where proceedings are instituted under thisAct against any person, nothing in thisAct shall be taken to require any person who has acted as attorney for the defendant to disclose any privileged communication made to him in that capacity.

Saving, etc.

391.Nothing in thisActshallaffect the incorporationofany company registered under the Companies Act (repeated by this Act), and the provisions of thisAct with respect to winding up shall not apply to any companyofwhich thewindinguphascommencedbefore theappointed day, but every such company shall be wound up in the same manner and with the same incidents as if thisAct had not been passed, and, for the purposes of the winding up, the law under which the winding up commenced shall be deemed to remain in full force.

392.—(1) The Minister shall have power by regulations to alter or add to the requirements of thisAct as to the matters to be stated in a company’s balance sheet, profit and loss account and group accounts andtherequirementsspecifiedin theSeventhScheduleandanyreference in this Act to the Schedule shall be construed as a reference to that Schedule with any alterations or additions made by regulations for the time being in force under this subsection.

(2) The Minister may by regulations alter or add to Tables A, B, C and D in the First Schedule and the form in Part II of the Fifth Schedule.

(3) Anyregulationsmadeunder subsection (1)which render more onerous the requirements therein referred to shall be subject to affirmativeresolution.

(4) Regulationsmadeunder thissectionnotbeingregulations to which subsection (3) applies, shall be subject to negative resolution.

393.—(1) In addition to the powers conferred upon the Minister by section 392 the Minister may make rules providing for all or any of the other matters which by this Act are to be prescribed by his authority.

Saving for privileged communications.

Savings.

Power to alter or add to certain requirements.

Seventh Schedule.

First Schedule. Fifth Schedule.

Power to make rules.

[No. ] The Companies Act, 2004274

(2) Notwithstanding the provisions of subsection (1), the Minister may make particular rules—

(a) prescribing the format and contents of returns, notices or other documents required to be sent to the Registrar or to be issued by the Registrar;

(b) prescribing the retention period for company records held by the Registrar; and

(c) respecting any other matter required for the efficient administration of this Act.

(3) Any rules made under this section shall be subject to affirmativeresolution.

394.—(1) There shall be paid to the Registrar of Companies in respect of the several matters mentioned in the Fifteenth Schedule the several fees therein specified.

(2) All fees paid under this section shall be paid into the Consolidated Fund.

(3) TheMinistermaybyorderamendtheFifteenthSchedule.

(4) Anordermadepursuant to subsection (3) shall be subject to negative resolution.

395. The Companies Act is hereby repealed and is hereinafter referred to as “the repealedAct”.

396.—(1) Upon the appointed day—

(a) all corporate instruments of an existing company; and

(b) all cancellations, suspensions, proceedings, etc., regulations and things,

lawfullydoneunderanyprovisionof the repealedAct shallbepresumed to have been lawfully done under thisAct and continue in effect under thisAct as though they had been lawfully done under thisAct.

(2) For the purpose of this section, “lawfully done” means to have been lawfully granted, issued, imposed, taken, done, commenced, filed, or passed, as the circumstances require.

Fees.

Repeal.

Transitional.

Fifteenth Schedule.

275The Companies Act, 2004 [No. ]

(3) Notwithstanding any other provision of this Act, but subject to subsection (4), if any provision of a corporate instrument of anexistingcompany lawfully in force immediatelybefore theappointed day is inconsistent with, repugnant to, or not in compliance with, this Act, that provision is not illegal or invalid by reason only of that inconsistency, repugnancy or non-compliance.

(4) Any act, matter or proceeding or thing done or taken by an existing company or any director, shareholder, member or officer thereof under a provision referred to in subsection (3), is not illegal or invalid by reason only of the inconsistency; repugnancy or non- compliancementionedinthatsubsection,orbyreasonofbeingprohibited or not authorized by thisAct.

(5) Section 177 applies to an existing company upon the appointed day.

(6) Where, on application by an existing company or its members, the Registrar determines that it is not practicable to change a reference to the nominal or par value of shares of a class or series that the existing company was authorized to issue before the appointed day, the Registrar may permit the company to continue to refer in its articles to those shares, whether issued or not, as shares having a nominal or par value.

(7) A share of an existing company issued before the appointed day shall be deemed to have been issued in compliance with thisAct, irrespective of—

(a) whether the share is fully paid;

(b) any designation, rights, privileges, restrictions or conditions attached to the share or set out on, or referred to in, the certificate representing the share,

and the provisions of this Act shall not be construed as depriving a shareholder of any right or privilege that he claims under an issued share of the company nor as relieving him of any liability in respect of such a share.

(8) Where any person is aggrieved by a decision of the Registrar, that person may appeal to the Supreme Court.

[No. ] The Companies Act, 2004276

SCHEDULES

FIRST SCHEDULE (Sections 2, 8, and 392 )

Tables A, B, C and D

TABLE A

PART I

Articles for Management of a Company Limited by shares

THE COMPANIESACT

ARTICLESOFINCORPORATION Company Limited by Shares

Articles for Management of a Company Limited by shares

1. Name of Company .........................................................................................

(a) Situation of Registered Office ..................................................................

2. Main Business of Company ..........................................................................

...........................................................................................................................

3. Liability of Members:—

Limited by Shares

4. Form of Company: Public

Private

The company is a private company and accordingly—

(a) the right to transfer shares is restricted in manner hereinafter prescribed;

(b) subject to section 25 (1) (b) of the Act, the number of members of the company (exclusive of persons who are in the employment of the company and of persons who having been formerly in the employment of the company were while in such employment and have continued after the determination of such employment to be members of the company) is limited to twenty:

Provided that where two or more persons hold one of more shares in the company jointly they shall for the purpose of this regulation be treated as a single member;

(c) any invitation to the public to subscribe for any shares or debentures of the company is prohibited;

(d) any invitation to the public to deposit money for fixed periods or payable on call whether bearing or not bearing interest is prohibited;

(e) subject to the exceptions provided for in the Twelfth Schedule any person other than the holder is prohibited from having any interest in any of the company’s shares; and

(f) the company shall not have power to issue share warrants to bearer.

277The Companies Act, 2004 [No. ]

5. Authorized Capital (if any)......................................................................................

(Public Companies should have an authorized minimum share capital of at least $500,000.00).

6. Article(s)......................................................... shall apply

shall not apply

7. In these articles—

“the Act” means the Companies Act;

“the seal” means the common seal of the company;

“secretary” means any person appointed to perform the duties of the secretary of the company.

Expressions referring to writing shall, unless the contrary intention appears, be construed as including references to printing, lithography, photography, and other modes of representing or reproducing words in a visible form.

Unless the context otherwise requires, words or expressions contained in these articles shall bear the same meaning as in the Act or any statutory modification thereof in force at the date at which these articles become binding on the company.

Share Capital and Variation of Rights

8. Without prejudice to any special rights previously conferred on the holders of any existing shares or class of shares, any share in the company may be issued with such preferred, deferred or other special rights or such restrictions, whether in regard to dividend, voting, return of capital or otherwise as the company may from time to time by ordinary resolution determine.

9. Subject to the provisions of section 56 of the Act, any preference shares may, with the sanction of an ordinary resolution, be issued on the terms that they are, or at the option of the company are liable, to be redeemed on such terms and in such manner as the company before the issue of the shares may by special resolution determine.

10. If at any time the share capital is divided into different classes of shares, the rights attached to any class (unless otherwise provided by the terms of issue of the shares of that class) may, whether or not the company is being wound up, be varied with the consent in writing of the holders of three-fourths of the issued shares of that class, or with the sanction of an extraordinary resolution passed at a separate general meeting of the holders of the shares of the class. To every such separate general meeting the provisions of these articles relating to general meetings shall apply, but so that the necessary quorum shall be two persons at least holding or representing by proxy one-third of the issued shares of the class

[No. ] The Companies Act, 2004278

and that any holder of shares of the class present in person or by proxy may demand a poll.

11. The rights conferred upon the holders of the shares of any class issued with preferred or other rights shall be deemed to be varied by the creation or issue of further shares ranking pari passu therewith.

12. The company may exercise the powers of paying commissions conferred by section 53 of the Act, provided that the rate per centum or the amount of the commission paid or agreed to be paid shall be disclosed in the manner required by that section and the rate of commission shall not exceed the rate of 10 per centum of the price at which the shares in respect whereof the same is paid are issued or an amount equal to 10 per centum of such price (as the case may be). Such commission may be satisfied by the payment of cash or the allotment of fully paid shares or partly in one way and partly in the other. The company may also on any issue of shares pay such brokerage as may be lawful.

13. Except as required by law, no person shall be recognized by the company as holding any share upon any trust, and the company shall not be bound by or be compelled in any way to recognize (even when having notice thereof) any equitable, contingent, future or partial interest in any share or any interest in any fractional part of a share or (except only as by these articles or by law otherwise provided) any other rights in respect of any share except an absolute right to the entirety thereof in the registered holder.

14. Every person whose name is entered as a member in the register of members shall be entitled without payment to receive within two months after allotment or lodgment of transfer (or within such other period as the conditions of issue shall provide) one certificate for all his shares or several certificates each for one or more of his shares upon payment of Two Dollars for every certificate after the first or such less sum as the directors shall from time to time determine. Every certificate shall be under the seal and shall specify the shares to which it relates and the amount paid up thereon. Provided that in respect of a share or shares held jointly by several persons the company shall not be bound to issue more than one certificate, and delivery of a certificate for a share to one of several joint holders shall be sufficient delivery to all such holders.

15. If a share certificate be defaced, lost or destroyed, it may be renewed on payment of a fee of Two Dollars or such less sum and on such terms (if any) as to evidence and indemnity and the payment of out-of-pocket expenses of the company of investigating evidence as the directors think fit.

16. The company shall not give, whether directly or indirectly, and whether by means of a loan, guarantee, the provision of security or otherwise, any financial assistance for the purpose of or in connection with a purchase or subscription made or to be made by any person of or for any shares in the company or in its holding company nor shall the company make a loan for any purpose whatsoever on the security of its shares or those of its holding company.

279The Companies Act, 2004 [No. ]

Lien

17. The company shall have a first and paramount lien on every share (not being a fully paid share) for all moneys (whether presently payable or not) called or payable at a fixed time in respect of that share, and the company shall also have a first and paramount lien on all shares (other than fully paid shares) standing registered in the name of a single person for all moneys presently payable by him or his estate to the company; but the directors may at any time declare any share to be wholly or in part exempt from the provisions of this regulation. The company's lien, if any, on a share shall extend to all dividends payable thereon.

18. The company may sell, in such manner as the directors think fit, any shares on which the company has a lien, but no sale shall be made unless a sum in respect of which the lien exists is presently payable, nor until the expiration of fourteen days after a notice in writing, stating and demanding payment of such part of the amount in respect of which the lien exists as is presently payable, has been given to the registered holder for the time being of the share, or the person entitled thereto by reason of his death or bankruptcy.

19. To give effect to any such sale the directors may authorize some person to transfer the shares sold to the purchaser thereof. The purchaser shall be registered as the holder of the shares comprised in any such transfer, and he shall not be bound to see to the application of the purchase money, nor shall his title to the share be affected by any irregularity or invalidity in the proceedings in reference to the sale.

20. The proceeds of the sale shall be received by the company and applied in payment of such part of the amount in respect of which the lien exists as is presently payable, and the residue, if any, shall (subject to a like lien for sums not presently payable as existed upon the shares before the sale) be paid to the person entitled to the shares at the date of the sale.

Calls on Shares

21. The directors may from time to time make calls upon the members in respect of any moneys unpaid on their shares and not by the conditions of allotment thereof made payable at fixed times, provided that no call shall exceed one-fourth of the nominal value of the share or be payable at less than one month from the date fixed for the payment of the last preceding call, and each member shall (subject to receiving at least fourteen days' notice specifying the time or times and place of payment) pay to the company at the time or times and place so specified the amount called on his shares. A call may be revoked or postponed as the directors may determine.

[No. ] The Companies Act, 2004280

22. Acall shall be deemed to have been made at the time when the resolution of the directors authorizing the call was passed and may be required to be paid by instalments.

23. The joint holders of a share shall be jointly and severally liable to pay all calls in respect thereof.

24. If a sum called in respect of a share is not paid before or on the day appointed for payment thereof, the person from whom the sum is due shall pay interest on the sum from the day appointed for payment thereof to the time of actual payment at such rate not exceeding 5 per centum per annum as the directors may determine, but the directors shall be at liberty to waive payment of such interest wholly or in part.

25. Any sum which by the terms of issue of a share becomes payable on allotment or at any fixed date, whether on account of the nominal value of the share or by way of premium, shall for the purposes of these regulations be deemed to be a call duly made and payable on the date on which by the terms of issue the same becomes payable, and in case of non-payment all the relevant provisions of these regulations as to payment of interest and expenses, forfeiture or otherwise shall apply as if such sum had become payable by virtue of a call duly made and notified.

26. The directors may, on the issue of shares, differentiate between the holders as to the amount of calls to be paid and the times of payment.

27. The directors may, if they think fit, receive from any member willing to advance the same, all or any part of the moneys uncalled and unpaid upon any shares held by him, and upon all or any of the moneys so advanced may (until the same would, but for such advance, become payable) pay interest at such rate not exceeding (unless the company in general meeting shall otherwise direct) 5 per centum per annum, as may be agreed upon between the directors and the member paying such sum in advance.

Transfer of Shares

28. The instrument of transfer of any share shall be executed by or on behalf of the transferor and transferee, and the transferor shall be deemed to remain a holder of the share until the name of the transferee is entered in the register of members in respect thereof.

29. Subject to such of the restrictions of these regulations as may be applicable, any member may transfer all or any of his shares by instrument in writing in any usual or common form or any other form which the directors may approve.

30. The directors may decline to register the transfer of a share (not being a fully paid share) to a person of whom they shall not approve, and they may also decline to register the transfer of a share on which the company has a lien.

281The Companies Act, 2004 [No. ]

31. The directors may also decline to recognize any instrument of transfer unless—

(a) a fee of Two Dollars or such lesser sum as the directors may from time to time require is paid to the company in respect thereof;

(b) the instrument of transfer is accompanied by the certificate of the shares to which it relates, and such other evidence as the directors may reasonably require to show the right of the transferor to make the transfer; and

(c) the instrument of transfer is in respect of only one class of share.

32. If the directors refuse to register a transfer they shall within two months after the date on which the transfer was lodged with the company send to the transferee notice of the refusal.

33. The registration of transfers may be suspended at such times and for such periods as the directors may from time to time determine, provided always that such registration shall not be suspended for more than thirty days in any year.

34. The company shall be entitled to charge a fee not exceeding Two Dollars on the registration of every probate, letters of administration, certificate of death or marriage, power of attorney, notice in lieu of distringas, or other instrument.

Transmission of Shares

35. In case of the death of a member the survivor or survivors where the deceased was a joint holder, and the legal personal representatives of the deceased where he was a sole holder, shall be the only persons recognized by the company as having any title to his interest in the shares; but nothing herein contained shall release the estate of a deceased joint holder from any liability in respect of any share which had been jointly held by him with other persons.

36. Any person becoming entitled to a share in consequence of the death or bankruptcy of a member may, upon such evidence being produced as may from time to time properly be required by the directors and subject as hereinafter provided, elect either to be registered himself as holder of the share or to have some person nominated by him registered as the transferee thereof.

37. If the person so becoming entitled shall elect to be registered himself, he shall deliver or send to the company a notice in writing signed by him stating that he so elects. If he shall elect to have another person registered he shall testify his election by executing to that person a transfer of the share. All the limitations, restrictions and provisions of these articles relating to the right to transfer and the registration of transfers of shares shall be applicable to any such notice or transfer as aforesaid as if the death or bankruptcy of the member had not occurred and the notice or transfer were a transfer signed by that member.

[No. ] The Companies Act, 2004282

38. Aperson becoming entitled to a share by reason of the death or bankruptcy of the holder shall be entitled to the same dividends and other advantages to which he would be entitled if he were the registered holder of the share, except that he shall not, before being registered as a member in respect of the share, be entitled in respect of it to exercise any right conferred by membership in relation to meetings of the company:

Provided always that the directors may at any time give notice requiring any such person to elect either to be registered himself or to transfer the share, and if the notice is not complied with within ninety days the directors may there-after withhold payment of all dividends, bonuses or other moneys payable in respect of the share until the requirements of the notice have been complied with.

Forfeiture of Shares

39. If a member fails to pay any call or instalment of a call on the day appointed for payment thereof, the directors may, at any time thereafter during such time as any part of the call or instalment remains unpaid, serve a notice on him requiring payment of so much of the call or instalment as is unpaid, together with any interest which may have accrued.

40. The notice shall name a further day (not earlier than the expiration of fourteen days from the date of service of the notice) on or before which the payment required by the notice is to be made, and shall state that in the event of non-payment at or before the time appointed the shares in respect of which the call was made will be liable to be forfeited.

41. If the requirements of any such notice as aforesaid are not complied with, any share in respect of which the notice has been given may at any time thereafter, before the payment required by the notice has been made, be forfeited by a resolution of the directors to that effect.

42. A forefeited share may be sold or otherwise disposed of on such terms and in such manner as the directors think fit, and at any time before a sale or disposition the forfeiture may be cancelled on such terms as the directors think fit.

43. A person whose shares have been forfeited shall cease to be a member in respect of the forfeited shares, but shall, notwithstanding, remain liable to pay to the company all moneys which, at the date of forfeiture were payable by him to the company in respect of the shares, but his liability shall cease if and when the company shall have received payment in full of all such moneys in respect of the shares.

44. A statutory declaration in writing that the declarant is a director or the secretary of the company, and that a share in the company has been duly forfeited on a date stated in the declaration, shall be conclusive evidence of the facts therein stated as against all persons claiming to be entitled to the share. The

283The Companies Act, 2004 [No. ]

company may receive the consideration, if any, given for the share on any sale or disposition thereof and may execute a transfer of the share in favour of the person to whom the share is sold or disposed of and he shall thereupon be registered as the holder of the share, and shall not be bound to see to the application of the purchase money, if any, nor shall his title to the share be affected by any irregularity or invalidity in the proceedings in reference to the forfeiture, sale or disposal of the share.

45. The provisions of these regulations as to forfeiture shall apply in the case of non-payment of any sum which, by the terms of issue of a share, becomes payable at a fixed time, as if the same had been payable by virtue of a call duly made and notified.

Conversion of Shares into Stock

46. The company may by ordinary resolution convert any paid-up shares into stock, and reconvert any stock into paid-up shares of any denomination.

47. The holders of stock may transfer the same, or any part thereof, in the same manner, and subject to the same articles, as and subject to which the shares from which the stock arose might previously to conversion have been transferred, or as near thereto as circumstances admit; and the directors may from time to time fix the minimum amount of stock transferable but so that such minimum shall not exceed the value of the shares from which the stock arose.

48. The holders of stock shall, according to the amount of stock held by them, have the same rights, privileges and advantages as regards dividends, voting at meetings of the company and other matters as if they held the shares from which the stock arose, but no such privilege or advantage (except participation in the dividends and profits of the company and in the assets on winding up) shall be conferred by an amount of stock which would not, if existing in shares, have conferred that privilege or advantage.

49. Such of the articles of the company as are applicable to paid-up shares shall apply to stock, and the words “share” and “shareholder” therein shall include “stock” and “stockholder”.

Alteration of Capital

50. The company may from time to time by ordinary resolution increase the share capital by such sum, to be divided into shares of such amount, as the resolution shall prescribe.

51. The company may by ordinary resolution—

(a) consolidate and divide all or any of its share capital into shares of larger amount than its existing shares;

(b) subdivide its existing shares, or any of them, into shares of smaller amount than is fixed by the articles subject nevertheless to the provisions of section 65 (1)(d) of the Act;

[No. ] The Companies Act, 2004284

(c) cancel any shares which, at the date of the passing of the resolution, have not been taken or agreed to be taken by any person.

52. The company may by special resolution reduce its share capital, any capital redemption reserve fund in any manner and with, and subject to, any incident authorized, and consent required, by law.

General Meetings

53. The company shall in each year hold a general meeting as its annual general meeting in addition to any other meetings in that year, and shall specify the meeting as such in the notices calling it; and not more than fifteen months shall elapse between the date of one annual general meeting of the company and that of the next. Provided that so long as the company holds it first annual general meeting within eighteen months of its incorporation, it need not hold it in the year of its incorporation or in the following year. The annual general meeting shall be held at such time and place as the directors shall appoint.

54. All general meetings other than annual general meeting shall be called extraordinary general meetings.

55. The directors may, whenever they think fit, convene an extraordinary general meeting, an extraordinary general meeting shall also be convened on such requisition, or, in default, may be convened by such requisitionists, as provided by section 128 of the Act. If at any time there are not within the Island sufficient directors capable of acting to form a quorum, any director or any two members of the company may convene an extraordinary general meeting in the same manner as nearly as possible as that in which meetings may be convened by the directors.

Notice of General Meetings

56. An annual general meeting and a meeting called for the passing of a special resolution shall be called by twenty-one days’ notice in writing at the least, and a meeting of the company other than an annual general meeting or a meeting for the passing of a special resolution shall be called by fourteen days’ notice in writing at the least. The notice shall be exclusive of the day on which it is served or deemed to be served and of the day for which it is given, and shall specify the place, the day and the hour of meeting and, in case of special business, the general nature of that business, and shall be given in manner hereinafter mentioned or in such other manner, if any, as may be prescribed by the company in general meeting, to such persons as are, under the regulations of the company, entitled to receive such notices from the company:

Provided that a meeting of the company shall, notwithstanding that it is called by shorter notice than that specified in this article, be deemed to have been duly called if it is so agreed—

(a) in the case of a meeting called as the annual general meeting, by all the members entitled to attend and vote thereat; and

285The Companies Act, 2004 [No. ]

(b) in the case of any other meeting, by a majority in number of the members having a right to attend and vote at the meeting, being a majority together holding not less than 95 per centum of the shares giving that right.

57. The accidental omission to give notice of a meeting to, or the non-receipt of notice of a meeting by, any person entitled to receive notice shall not invalidate the proceedings at that meeting.

Proceedings at General Meetings

58. All business shall be deemed special that is transacted at an extraordinary general meeting, and also all that is transacted at an annual general meeting, with the exception of declaring a dividend, the consideration of the accounts, balance sheets, and the reports of the directors and auditors, the election of directors in the place of those retiring and the appointment of, and the fixing of the remuneration of, the auditors.

59. No business shall be transacted at any general meeting unless a quorum of members is present at the time when the meeting proceeds to business; save as herein otherwise provided, three members present in person shall be a quorum.

60. If within half an hour from the time appointed for the meeting a quorum is not present, the meeting, if convened upon the requisition of members, shall be dissolved; in any other case it shall stand adjourned to the same day in the next week, at the same time and place or to such other day and at such other time and place as the directors may determine, and if at the adjourned meeting a quorum is not present within half an hour from the time appointed for the meeting, the members present shall be a quorum.

61. The chairman, if any, of the board of directors shall preside as chairman at every general meeting of the company, or if there is no such chairman, or if he shall not be present within fifteen minutes after the time appointed for the holding of the meeting or is unwilling to act the directors present shall elect one of their number to be chairman of the meeting.

62. If at any meeting no director is willing to act as chairman or if no director is present within fifteen minutes after the time appointed for holding the meeting, the members present shall choose one of their number to be chairman of the meeting.

63. The chairman may, with the consent of any meeting at which a quorum is present (and shall if so directed by the meeting), adjourn the meeting from time to time and from place to place, but no business shall be transacted at any adjourned meeting other than the business left unfinished at the meeting from which the adjournment took place. When a meeting is adjourned for thirty days or more, notice of the adjourned meeting shall be given as in the case of an

[No. ] The Companies Act, 2004286

original meeting. Save as aforesaid it shall not be necessary to give any notice of an adjournment or of the business to be transacted at an adjourned meeting.

64. At any general meeting a resolution put to the vote of the meeting shall be decided on a show of hands unless a poll is (before or on the declaration of the result of the show of hands) demanded—

(a) by the chairman; or

(b) by at least three members present in person or by proxy; or

(c) by any member or members present in person or by proxy and representing not less than one-tenth of the total voting rights of all the members having the right to vote at the meeting; or

(d) by a member or members holding shares in the company conferring a right to vote at the meeting being shares on which an aggregate sum has been paid up equal to not less than one-tenth of the total sum paid up on all the shares conferring that right.

Unless a poll be so demanded a declaration by the chairman that a resolution has on a show of hands been carried or carried unanimously, or by a particular majority, or lost and an entry to that effect in the book containing the minutes of the proceedings of the company shall be conclusive evidence of the fact without proof of the number or proportion of the votes recorded in favour of or against such resolution.

The demand for a poll may be withdrawn.

65. Except as provided in article 67, if a poll is duly demanded it shall be taken in such manner as the chairman directs, and the result of the poll shall be deemed to be the resolution of the meeting at which the poll was demanded.

66. In the case of an equality of votes, whether on a show of hands or on a poll, the chairman of the meeting at which the show of hands takes place or at which the poll is demanded, shall be entitled to a second or casting vote.

67. A poll demanded on the election of a chairman or on a question of adjournment shall be taken forthwith. A poll demanded on any other question shall be taken at such time as the chairman of the meeting directs, and any business other than that upon which a poll has been demanded may be proceeded with pending the taking of the poll.

Votes of Members

68. Subject to any rights or restrictions for the time being attached to any class or classes of shares, on a show of hands every member present in person shall have one vote, and on a poll every member shall have one vote for each share of which he is the holder.

287The Companies Act, 2004 [No. ]

69. In the case of joint holders the vote of the senior who tenders a vote, whether in person or by proxy, shall be accepted to the exclusion of the votes of the other joint holders; and for this purpose seniority shall be determined by the order in which the names stand in the register of members.

70. A member of unsound mind, or in respect of whom an order has been made by any court having jurisdiction in lunacy, may vote, whether on a show of hands or on a poll, by his committee, receiver, or other person in the nature of a committee or receiver appointed by that court, and any such committee, receiver, or other person may on a poll vote by proxy.

71. No member shall be entitled to vote at any general meeting unless all calls or other sums presently payable by him in respect of shares in the company have been paid.

72. No objection shall be raised to the qualification of any voter except at the meeting or adjourned meeting at which the vote objected to is given or tendered, and every vote not disallowed at such meeting shall be valid for all purposes. Any such objection made in due time shall be referred to the chairman of the meeting, whose decision shall be final and conclusive.

73. On a poll votes may be given either personally or by proxy.

74. The instrument appointing a proxy shall be in writing under the hand of the appointer or of his attorney duly authorized in writing, or, if the appointer is a corporation, either under seal, or under the hand of an officer or attorney duly authorized. A proxy need not be a member of the company.

75. The instrument appointing a proxy and the power of attorney or other authority, if any, under which it is signed, or a notarially certified copy, of that power or authority shall be deposited at the registered office of the company or at such other place within the Island as is specified for that purpose in the notice convening the meeting, not less than 48 hours before the time for holding the meeting or adjourned meeting, at which the person named in the instrument proposes to vote, or in the case of a poll not less than 24 hours before the time appointed for the taking of the poll, and in default the instrument of proxy shall not be treated as valid.

76. An instrument appointing a proxy shall be in the following form or a form as near thereto as circumstances admit—

“ Company, Limited I/ We , of ,

being a member/members of the abovenamed company, hereby appoint of ,or failing him, of , as my/our proxy to vote for me/us on my/our behalf at the [annual or extraordinary, as the case may be] general meeting of the company to be held on the day of , and at any adjournment thereof.

[No. ] The Companies Act, 2004288

Signed this day of .”

77. Where it is desired to afford members an opportunity of voting for or against a resolution the instrument appointing a proxy shall be in the following form or a form as near thereto as circumstances admit—

“ Company, Limited I/We of , being a member/members of the abovenamed company, hereby appoint of

, or failing him, of , as my/our proxy to vote for me/us on my/our behalf at the [annual or

extraordinary, as the case may be] general meeting of the company to be held on the day of , and at any adjournment thereof.

Signed this day of .” This form is to be used *in favour of the resolution. Unless otherwise

––––––––– against

instructed, the proxy will vote as he thinks fit.

* Strike out whichever is not desired.

78. The instrument appointing a proxy shall be deemed to confer authority to demand or join in demanding a poll.

79. Avote given in accordance with the terms of an instrument of proxy shall be valid notwithstanding the previous death or insanity of the principal or revocation of the proxy or of the authority under which the proxy was executed, on the transfer of the share in respect of which the proxy is given, provided that no intimation in writing of such death, insanity, revocation or transfer as aforesaid shall have been received by the company at the office before the commencement of the meeting or adjourned meeting at which the proxy is used.

Corporations acting by Representatives at Meetings

80. Any corporation which is a member of the company may by resolution of its directors or other governing body authorize such person as it thinks fit to act as its representative at any meeting of the company or of any class of members of the company, and the person so authorized shall be entitled to exercise the same powers on behalf of the corporation which he represents as that corporation could exercise if it were an individual member of the company.

Directors

81. The number of directors and the names of the first directors shall be determined in writing by the subscribers of the articles or a majority of them.

82. The remuneration of the directors shall from time to time be determined by the company in general meeting. Such remuneration shall be deemed to accrue

289The Companies Act, 2004 [No. ]

from day to day. The directors may also be paid all travelling, hotel and other expenses properly incurred by them in attending and returning from meetings of the directors or any committee of the directors or general meetings of the company or in connection with the business of the company.

83. The shareholding qualification for directors may be fixed by the company in general meeting, and unless and until so fixed no qualification shall be required.

84. Adirector of the company may be or become a director or other officer of, or otherwise interested in, any company promoted by the company or in which the company may be interested as shareholder or otherwise, and no such director shall be accountable to the company for any remuneration or other benefits received by him as a director or officer of, or from his interest in, such other company unless the company otherwise direct.

Borrowing Powers

85. The directors may exercise all the powers of the company to borrow money, and to mortgage or charge its undertaking, property and uncalled capital, or any part thereof, and to issue debentures, debenture stock, and other securities whether outright or as security for any debt, liability or obligation of the company or of any third party:

Provided that the amount for the time being remaining undischarged of moneys borrowed or secured by the directors as aforesaid (apart from temporary loans obtained from the company’s bankers in the ordinary course of business) shall not at any time, without the previous sanction of the company in general meeting, exceed the amount of the share capital of the company for the time being issued, but nevertheless no lender or other person dealing with the company shall be concerned to see or inquire whether this limit is observed. No debt incurred or security given in excess of such limit shall be invalid or ineffectual except in the case of express notice to the lender or the recipient of the security at the time when the debt was incurred or security given that the limit hereby imposed had been or was thereby exceeded.

Powers and Duties of Directors

86. The business of the company shall be managed by the directors, who may pay all expenses incurred in promoting and registering the company, and may exercise all such powers of the company as are not, by the Act or by these articles, required to be exercised by the company in general meeting, subject, nevertheless, to any of these articles, to the provisions of the Act and to such articles, being not inconsistent with the aforesaid articles or provisions, as may be prescribed by the company in general meeting; but no articles made by the company in general meeting shall invalidate any prior act of the directors which would have been valid if that article had not been made.

87. The directors may from time to time and at any time by power of attorney appoint any company, firm or person or body of persons, whether nominated

[No. ] The Companies Act, 2004290

directly or indirectly by the directors, to be the attorney or attorneys of the company for such purposes and with such powers, authorities and discretions (not exceeding those vested in or exercisable by the directors under these articles) and for such period and subject to such conditions as they may think fit and any such powers of attorney may contain such provisions for the protection and convenience of persons dealing with any such attorney as the directors may think fit and may also authorize any such attorney to delegate all or any of the powers, authorities and discretions vested in him.

88. The company may exercise the powers conferred by section 32 of theAct with regard to having an official seal for use abroad, and such powers shall be vested in the directors.

89. The company may exercise the powers conferred upon the company by virtue of sections of the Act with regard to the keeping of branch registers of holders of debentures and members and the directors may (subject to the provisions of those sections) make and vary such articles as they may think fit respecting the keeping of any such registers.

90.—(1) Adirector who is, in any way, whether directly or indirectly, interested in a contract or proposed contract with the company shall declare the nature and extent of his interest at a meeting of the directors in accordance with section 193 of the Act.

(2) A director shall not vote in respect of any contract or arrangement in which he is interested, and if he shall do so his vote shall not be counted, nor shall he be counted in the quorum present at the meeting, but neither of these prohibitions shall apply to—

(a) any arrangement for giving any director any security or indemnity in respect of money lent by him to or obligations undertaken by him for the benefit of the company; or

(b) any arrangement for the giving by the company of any security to a third party in respect of a debt or obligation of the company for which the director himself has assumed responsibility in whole or in part under a guarantee or indemnity or by the deposit of a security; or

(c) any contract by a director to subscribe for or underwrite shares or debentures of the company; or

(d) any contract or arrangement with any other company in which he is interested only as an officer of the company or as holder of shares or other securities,

and these prohibitions may at any time be suspended or relaxed to any extent, and either generally or in respect of any particular contract, arrangement or transaction, by the company in general meeting.

291The Companies Act, 2004 [No. ]

(3) A director may hold any other office or place of profit under the company (other than the office of auditor) in conjunction with his office of director for such period and on such terms (as to remuneration and otherwise) as the directors may determine and no director or intending director shall be disqualified by his office from contracting with the company either with regard to his tenure of any such other office or place of profit or as vendor, purchaser or otherwise, nor shall any such contract, or any contract or arrangement entered into by or on behalf of the company in which any director is in any way interested, be liable to be avoided, nor shall any director so contracting or being so interested be liable to account to the company for any profit realized by any such contract or arrangement by reason of such director holding that office or of the fiduciary relation thereby established.

(4) A director, notwithstanding his interest, may be counted in the quorum present at any meeting whereat he or any other director is appointed to hold any such office or place of profit under the company or whereat the terms of any such appointment are arranged, and he may vote on any such appointment or arrangement other than his own appointment or the arrangement of the terms thereof.

(5) Any director may act by himself or his firm in a professional capacity for the company, and he or his firm shall be entitled to remuneration for professional services as if he were not a director; provided that nothing herein contained shall authorize a director or his firm to act as auditor to the company.

91. All cheques, promissory notes, drafts, bills of exchange and other negotiable instruments, and all receipts for moneys paid to the company, shall be signed, drawn, accepted, indorsed, or otherwise executed, as the case may be, in such manner as the directors shall from time to time by resolution determine.

92. The directors shall cause minutes to be made in books provided for the purpose—

(a) of all appointments of officers made by the directors;

(b) of the names of the directors present at each meeting of the directors and of any committee of the directors;

(c) of all resolutions and proceedings at all meetings of the company, and of the directors, and of committees of directors, and every director present at any meeting of directors or committee of directors shall sign his name in a book to be kept for that purpose.

93. The directors on behalf of the company may pay a gratuity or pension or allowance on retirement to any director who has held any other salaried office or place of profit with the company or to his widow or dependants and may make contributions to any fund and pay premiums for the purchase or provision of any such gratuity, pension or allowance.

[No. ] The Companies Act, 2004292

Disqualification of Directors

94. The office of director shall be vacated, if the director—

(a) ceases to be a director by virtue of section 177 of the Act; or

(b) becomes bankrupt or makes any arrangement or composition with his creditors generally; or

(c) becomes prohibited from being a director by reason of any order made under sections 180 and 182 of the Act; or

(d) becomes of unsound mind; or

(e) resigns his office by notice in writing to the company; or

(f) shall for more than six months have been absent without permission of the directors from meetings of the directors held during that period.

Rotation of Directors

95. At the first annual general meeting of the company, all the directors shall retire from office, and at the annual general meeting in every subsequent year one-third of the directors for the time being or, if their number is not three or a multiple of three, then the number nearest one-third, shall retire from office.

96. The directors to retire in every year shall be those who have been longest in office since their last election, but as between persons who became directors on the same day those to retire shall (unless they otherwise agree among themselves) be determined by lot.

97. Aretiring director shall be eligible for re-election.

98. The company at the meeting at which a director retires in manner aforesaid may fill the vacated office by electing a person thereto, and in default the retiring director shall if offering himself for re-election be deemed to have been re-elected, unless at such meeting it is expressly resolved not to fill such vacated office or unless a resolution for the re-election of such director shall have been put to the meeting and lost.

99. No person other than a director retiring at the meeting shall unless recommended by the directors be eligible for election to the office of director at any general meeting unless not less than three nor more than twenty-one days before the date appointed for the meeting there shall have been left at the registered office of the company notice in writing, signed by a member duly qualified to attend and vote at the meeting for which such notice is given, of his intention to propose such person for election, and also notice in writmg signed by that person of his willingness to be elected.

100. The company may from time to time by ordinary resolution increase or reduce the number of directors, and may also determine in what rotation the increased or reduced number is to go out of office.

293The Companies Act, 2004 [No. ]

101. The directors shall have power at any time, and from time to time, to appoint any person to be a director, either to fill a casual vacancy or as an addition to the existing directors, but so that the total number of directors shall not at any time exceed the number fixed in accordance with these articles. Any director so appointed shall hold office only until the next following annual general meeting, and shall then be eligible for re-election but shall not be taken into account in determining the directors who are to retire by rotation at such meeting.

102. The company may by ordinary resolution remove any director before the expiration of his period of office notwithstanding anything in these articles or in any agreement between the company and such director. Such removal shall be without prejudice to any claim such director may have for damages for breach of any contract of service between him and the company.

103. The company may by ordinary resolution appoint another person in place of a director removed from office under article 102, and without prejudice to the powers of the directors under article 101 the company in general meeting may appoint any person to be a director either to fill a casual vacancy or as an additional director.Aperson appointed in place of a director so removed or to fill such a vacancy shall be subject to retirement at the same time as if he had become a director on the day on which the director in whose place he is appointed was last elected a director.

Proceedings of Directors

104. The directors may meet together for the despatch of business, adjourn, and otherwise regulate their meetings, as they think fit. Questions arising at any meeting shall be decided by a majority of votes. In case of an equality of votes, the chairman shall have a second or casting vote. A director may, and the secretary on the requisition of a director shall, at any time summon a meeting of the directors. It shall not be necessary to give notice of a meeting of directors to any director for the time being absent from the Island.

105. The quorum necessary for the transaction of the business of the directors may be fixed by the directors, and unless so fixed shall be two.

106. The continuing directors may act notwithstanding any vacancy in their body, but, if and so long as their number is reduced below the number fixed by or pursuant to the articles of the company as the necessary quorum of directors, the continuing directors or director may act for the purpose of increasing the number of directors to that number, or of summoning a general meeting of the company, but for no other purpose.

107. The directors may elect a chairman of their meetings and determine the period for which he is to hold office; but if no such chairman is elected, or if at any meeting the chairman is not present within five minutes after the time appointed for holding the same, the directors present may choose one of their number to be chairman of the meeting.

[No. ] The Companies Act, 2004294

108. The directors may delegate any of their powers to committees consisting of such member or members of their body as they think fit; any committee so formed shall in the exercise of the powers so delegated conform to any articles that may be imposed on it by the directors.

109. Acommittee may elect a chairman of its meetings; if no such chairman is elected, or if at any meeting the chairman is not present within five minutes after the time appointed for holding the same, the members present may choose one of their number to be chairman of the meeting.

110. Acommittee may meet and adjourn as it thinks proper. Questions arising at any meeting shall be determined by a majority of votes of the members present, and in the case of an equality of votes the chairman shall have a second or casting vote.

111. All acts done by any meeting of the directors or of a committee of directors or by any person acting as a director shall, notwithstanding that it be afterwards discovered that there was some defect in the appointment of any such director or person acting as aforesaid, or that they or any of them were disqualified, be as valid as if every such person had been duly appointed and was qualified to be a director.

112. A resolution in writing, signed by all the directors for the time being entitled to receive notice of a meeting of the directors, shall be as valid and effectual as if it had been passed at a meeting of the directors duly convened and held.

Managing Director

113. The directors may from time to time appoint one or more of their body to the office of managing director for such period and on such terms as they think fit, and, subject to the terms of any agreement entered into in any particular case, may revoke such appointment. A director so appointed shall not, whilst holding that office, be subject to retirement by rotation or be taken into account in determining the rotation of retirement of directors, but his appointment shall be automatically determined if he ceases from any cause to be a director.

114. Amanaging director shall receive such remuneration (whether by way of salary, commission or participation in profits, or partly in one way and partly in another) as the directors may determine.

115. The directors may entrust to and confer upon a managing director any of the powers exercisable by them upon such terms and conditions and with such restrictions as they may think fit, and either collaterally with or to the exclusion of their own powers and may from time to time revoke, withdraw, alter or vary all or any of such powers.

295The Companies Act, 2004 [No. ]

Secretary

116. The secretary shall be appointed by the directors for such term, at such remuneration and upon such conditions as they may think fit; and any secretary so appointed may be removed by them.

117. No person shall be appointed or hold office as secretary who is—

(a) the sole director of the company; or

(b) a corporation the sole director of which is the sole director of the company; or

(c) the sole director of a corporation which is the sole director of the company.

118. Aprovision of theAct or these articles requiring or authorizing a thing to be done by or to a director and the secretary shall not be satisfied by its being done by or to the same person acting both as director and as, or in place of, the secretary.

The Seal

119. The directors shall provide for the safe custody of the seal, which shall only be used by the authority of the directors or of a committee of the directors authorized by the directors in that behalf, and every instrument to which the seal shall be affixed shall be signed by a director and shall be countersigned by the secretary or by a second director or by some other person appointed by the directors for the purpose.

Dividends and Reserve

120. The company in general meeting may declare dividends, but no dividend shall exceed the amount recommended by the directors.

121. The directors may from time to time pay to the members such interim dividends as appear to the directors to be justified by the profits of the company.

122. No dividend shall be paid otherwise than out of profits.

123. The directors may, before recommending any dividend, set aside out of the profits of the company such sums as they think proper as a reserve or reserves which shall, at the discretion of the directors, be applicable for any purpose to which the profits of the company may be properly applied, and pending such application may, at the like discretion, either be employed in the business of the company or be invested in such investments (other than shares of the company) as the directors may from time to time think fit. The directors may also without placing the same to reserve carry forward any profits which they may think prudent not to divide.

[No. ] The Companies Act, 2004296

124. Subject to the rights of persons, if any, entitled to shares with special rights as to dividend, all dividends shall be declared and paid according to the amounts paid or credited as paid on the shares in respect whereof the dividend is paid, but no amount paid or credited as paid on a share in advance of calls shall be treated for the purposes of this article as paid on the share. All dividends shall be apportioned and paid proportionately to the amounts paid or credited as paid on the shares during any portion or portions of the period in respect of which the dividend is paid; but if any share is issued on terms providing that it shall rank for dividend as from a particular date such share shall rank for dividend accordingly.

125. The directors may deduct from any dividend payable to any member all sums of money (if any) presently payable by him to the company on account of calls or otherwise in relation to the shares of the company.

126. Any general meeting declaring a dividend or bonus may direct payment of such dividend or bonus wholly or partly by the distribution of specific assets and in particular of paid up shares, debentures or debenture stock of any other company or in any one or more of such ways and the directors shall give effect to such resolution, and where any difficulty arises in regard to such distribution, the directors may settle the same as they think expedient, and in particular may issue fractional certificates and fix the value for distribution of such specific assets or any part thereof and may determine that cash payments shall be made to any members upon the footing of the value so fixed in order to adjust the rights of all parties, and may vest any such specific assets in trustees as may seem expedient to the directors.

127. Any dividend, interest or other moneys payable in cash in respect of shares may be paid by cheque or warrant sent through the post directed to the registered address of the holder or, in the case of joint holders, to the registered address of that one of the joint holders who is first named on the register of members or to such person and to such address as the holder or joint holders may in writing direct. Every such cheque or warrant shall be made payable to the order of the person to whom it is sent. Any one of two or more joint holders may give effectual receipts for any dividends, bonuses or other moneys payable in respect of the shares held by them as joint holders.

128. No dividend shall bear interest against the company.

Accounts

129. The directors shall cause proper books of account to be kept with respect to—

(a) all sums of money received and expended by the company and the matters in respect of which the receipt and expenditure takes place;

297The Companies Act, 2004 [No. ]

(b) all sales and purchases of goods by the company; and

(c) the assets and liabilities of the company.

Proper books shall not be deemed to be kept if there are not kept such books of account as are necessary to give a true and fair view of the state of the company’s affairs and to explain its transactions.

130. The books of account shall be kept at the registered office of the company, or, subject to subsections (3) and (4) of section 144 of the Act, at such other place or places as the directors think fit, and shall always be open to the inspection of the directors.

131. The directors shall from time to time determine whether and to what extent and at what time and places and under what conditions or articles the accounts and books of the company or any of them shall be open to the inspection of members not being directors, and no member (not being a director) shall have any right of inspecting any account or book or document of the company except as conferred by law or authorized by the directors or by the company in general meeting.

132. The directors shall from time to time, in accordance with sections 145 and 147 of the Act, cause to be prepared and to be laid before the company in general meeting such profit and loss accounts, balance sheets, group accounts (if any) and reports as are referred in those sections.

133. A copy of every balance sheet (including every document required by law to be annexed thereto) which is to be laid before the company in general meeting, together with a copy of the auditor’s report, shall not less than twenty- one days before the date of the meeting be sent to every member of, and every holder of debentures of, the company and to every person registered under article 37. Provided that this article shall not require a copy of those documents to be sent to any person of whose address the company is not aware or to more than one of the Joint holders of any shares or debentures.

Capitalization of Profits

134. The company in general meeting may upon the recommendation of the directors resolve that it is desirable to capitalize any part of the amount for the time being standing to the credit of any of the company’s reserve accounts or to the credit of the profit and loss account or otherwise available for distribution, and accordingly that such sum be set free for distribution amongst the members who would have been entitled thereto if distributed by way of dividend and in the same proportions on condition that the same be not paid in cash but be applied either in or towards paying up any amounts for the time being unpaid on any shares held by such members respectively or towards paying up in full unissued shares or debentures of the company to be allotted and distributed credited as fully paid up to and amongst such members in the proportion aforesaid

[No. ] The Companies Act, 2004298

or partly in the one way and partly in the other, and the directors shall give effect to such resolution:

Provided that a share premium account and a capital redemption reserve fund may, for the purposes of this article, only be applied in the paying up of unissued shares to be issued to members of the company as fully paid bonus shares.

135. Whenever such a resolution as aforesaid shall have been passed the directors shall make all appropriations and applications of the undivided profits resolved to be capitalized thereby, and all allotments and issues of fully paid shares or debentures, if any, and generally shall do all acts and things required to give effect thereto, with full power to the directors to make such provision by the issue of fractional certificates or by payment in cash or otherwise as they think fit for the case of shares or debentures becoming distributable in fractions, and also to authorize any person to enter on behalf of all the members entitled thereto into an agreement with the company providing for the allotment to them respectively, credited as fully paid up, of any further shares or debentures to which they may be entitled upon such capitalization or (as the case may require) for the payment by the company on their behalf, by the application thereto of their respective profits resolved to be capitalized, of the amounts as any part of the amounts remaining unpaid on their existing shares, and any agreement made under such authority shall be effective and binding on all such members.

Audit

136. Auditors shall be appointed and their duties regulated in accordance with sections 154 to 157 of the Act.

Notices

137. A notice may be given by the company to any member either personally or by sending it by post to him or to his registered address or (if he has no registered address within the Island) to the address if any, within the Island supplied by him to the company for the giving of notice to him. Where a notice is sent by post, service of the notice shall be deemed to be effected by properly addressing, prepaying, and posting a letter containing the notice, and to have been effected in the case of a notice of a meeting at the expiration of 24 hours after the letter containing the same is posted, and in any other case at the time at which the letter would be delivered in the ordinary course of post.

138. A notice may be given by the company to the joint holders of a share by giving the notice to the joint holder firstnamed in the register of members in respect of the share.

139. A notice may be given by the company to the persons entitled to a share in consequence of the death or bankruptcy of a member by sending it through the post in a prepaid letter addressed to them by name, or by the title of

299The Companies Act, 2004 [No. ]

representatives of the deceased, or trustee of the bankrupt, or by any like description, at the address, if any, within the Island supplied for the purpose by the persons claiming to be so entitled, or (until such an address has been so supplied) by giving the notice in any manner in which the same might have been given if the death or bankruptcy had not occurred.

140. Notice of every general meeting shall be given in any manner hereinbefore authorized to—

(a) every member except those members who (having no registered address within the Island) have not supplied to the company an address within the Island for the giving of notices to them;

(b) every person upon whom the ownership of a share devolves by reason of his being a legal personal representative or a trustee in bankruptcy of a member where the member but for his death or bankruptcy would be entitled to receive notice of the meeting; and

(c) the auditor for the time being of the company.

No other person shall be entitled to receive notices of general meetings.

Winding up

141. If the company shall be wound up the liquidator may, with the sanction of an extraordinary resolution of the company and any other sanction required by the Act, divide amongst the members in specie or kind the whole or any part of the assets of the company (whether they shall consist of property of the same kind or not) and may, for such purpose set such value as he deems fair upon any property to be divided as aforesaid and may determine how such division shall be carried out as between the members or different classes of members. The liquidator may, with the like sanction, vest the whole or any part of such assets in trustees upon such trusts for the benefit of the contributories as the liquidator, with the like sanction, shall think fit, but so that no member shall be compelled to accept any shares or other securities whereon there is any liability.

Indemnity

142. Every director, managing director, agent, auditor, secretary and other officer for the time being of the company shall be indemnified out of the assets of the company against any liability incurred by him in defending any proceedings, whether civil or criminal, in which judgment is given in his favour or in which he is acquitted or in connection with any application under section 389 of the Act in which relief is granted to him by the Court.

PART II

Regulations for the Management of a Private Company Limited by Shares

[No. ] The Companies Act, 2004300

1. The regulations contained in Part I of TableA(with the exception of articles 30 and 59) shall apply.

2. The company is a private company and accordingly—

(a) the right to transfer shares is restricted in manner hereinafter prescribed;

(b) the number of members of the company (exclusive of persons who are in the employment of the company and of persons who having been formerly in the employment of the company were while in such employment and have continued after the determination of such employment to be members of the company) is limited to twenty:

Provided that where two or more persons hold one or more shares in the company jointly they shall for the purpose of this regulation be treated as a single member;

(c) any invitation to the public to subscribe for any shares or debentures of the company is prohibited;

(d) any invitation to the public to deposit money for fixed periods or payable on call whether bearing or not bearing interest is prohibited;

(e) subject to the exceptions provided for in the Twelfth Schedule to the Act any person other than the holder is prohibited from having any interest in any of the company's shares;

(f) the company shall not have power to issue share warrants to bearer.

3. The directors may, in their absolute discretion and without assigning any reason therefor, decline to register any transfer of any share whether or not it is a fully paid up share.

4. No business shall be transacted at any general meeting unless a quorum of members are present at the time when the meeting proceeds to business; save as herein otherwise provided two members present in person or by proxy shall be a quorum.

5. Subject to the provisions of the Act, a resolution in writing signed by all the members for the time being entitled to receive notice of and to attend and vote at general meetings (or being corporations by their duly authorized representatives) shall be as valid and effective as if the same had been passed at a general meeting of the company duly convened and held.

301The Companies Act, 2004 [No. ]

TABLE B

Form of Articles of a Company Limited by Guarantee, and not having a share capital

Form......................................

THE COMPANIES ACT

ARTICLES OF INCORPORATION

(Company Limited by Guarantee without Share Capital pursuant to S. 20.)

1. Name of Company................................................................................................ (hereinafter referred to as the association)

2. Situation of Registered Office............................................................................

3. Main Business of Company................................................................................

Commerce Art Science Religion

Charity Other

4. (a) State proposed number of members at time of

Registration.......................................................................................

(b) State terms of undertaking and extent of Guarantee:

Every member of the association undertakes to contribute to the assets of the association in the event of the same being wound up during the time that he is a member, or within one year afterwards, for payment of the debts and liabilities of the association contracted before the time at which he ceases to be a member, and of the costs, charges, and expenses of winding-up of the same, and for the adjustment of the rights of the contributors amongst themselves, such amount as may be required not exceeding dollars.

5. Form of Company: Private Public

6. No part of the net earnings of the Association shall inure to the benefit of, or be distributable to its members, directors, officers, or other private persons, except that theAssociation shall be authorized and empowered to pay reasonable compensation for services rendered and to make payments and distributions in furtherance of the purposes set forth in Article 3 hereof. The Association shall not support with its fund any purpose or object, or impose on or procure to be observed by its members or others any regulations, restrictions or conditions which if an object of the Association would make it a Trade Union.

7. The form of articles set forth in the Tenth Schedule is followed.

Yes No

[No. ] The Companies Act, 2004302

8. Restriction, if any on powers to amend Articles

No addition, alteration, or amendment shall be made to or in the regulations contained in Articles for the time being in force, unless the same shall have been previously submitted to and approved by the Minister.

9. Number (or minimum/maximum number) of Directors.....................................

......................................................................................................................................

10. Indicate Name(s) of First Directors for the time being, if any:

.....................................................................................................................................

11A. Restrictions, if any on business the company may carry on:

......................................................................................................................................

11B. The Corporation is formed exclusively for promotion of:

12. If upon the winding up or dissolution of the association there remains after the satisfaction of all its debts and liabilities, any property whatsoever, the same shall not be paid to or distributed among the members of the association, but shall be given or transferred to some other institution or institutions, having objects similar to the objects of the association and which shall prohibit the distribution of its or their income and property among its or their members to an extent at least as great as is imposed on the association under or by virtue of Article 5 hereof, such institution or institutions to be determined by the members of the association at or before the time of dissolution or in default thereof by such Judge of the Supreme Court as may have or acquire jurisdiction in the matter and if and so far as effect cannot be given to the aforesaid provision then to some charitable object.

13. True accounts shall be kept of the sums of money received and expended by the association and the matters in respect of which such receipts and expenditure take place and of the property, credits and liabilities of the association: and subject to any reasonable restrictions as to the time and manner of inspecting the same that may be imposed in accordance with the articles of the Association for the time being shall be opened to the inspection of the members. Once at least in every year the accounts of the association shall be examined and the correctness of the balance sheet ascertained by one or more properly qualified auditor or auditors.

Interpretation

14. In these articles—

“the Act” means the Companies Act;

“the seal” means the common seal of the company;

“secretary” means any person appointed to perform the duties of the secretary of the company.

303The Companies Act, 2004 [No. ]

Expressions referring to writing shall, unless the contrary intention appears, be construed as including references to printing, lithography, photography, and other modes of representing or reproducing words in a visible form.

Unless the context otherwise requires, words or expressions contained in these articles shall bear the same meaning as in the Act or any statutory modification thereof in force at the date at which these articles become binding on the company.

Members

15. The subscribers to the Articles of Association and such other persons as the directors shall admit to membership shall be members of the company.

General Meetings

16. The company shall in each year hold a general meeting as its annual general meeting in addition to any other meetings in that year, and shall specify the meeting as such in the notices calling it; and not more than fifteen months shall elapse between the date of one annual general meeting of the company and that of the next. Provided that so long as the company holds its first annual general meeting within eighteen months of its incorporation, it need not hold it in the year of its incorporation or in the following year. The annual general meeting shall be held at such time and place as the directors shall appoint.

17. All general meetings other than annual general meetings shall be called extraordinary general meetings.

18. The directors may, whenever they think fit, convene an extraordinary general meeting and extraordinary general meetings shall also be convened on such requisition, or, in default may be convened by such requisitionists, as provided by section 128 of the Act. If at any time there are not within the Island sufficient directors capable of acting to form a quorum, any director or any two members of the company may convene an extraordinary general meeting in the same manner as nearly as possible as that in which meetings may be convened by the directors.

Notice of General Meetings

19. An annual general meeting and a meeting called for the passing of a special resolution shall be called by twenty-one days’ notice in writing at the least, and a meeting of the company other than an annual general meeting or a meeting for the passing of a special resolution shall be called by fourteen days’ notice in writing at the least. The notice shall be exclusive of the day on which it is served or deemed to be served and of the day for which it is given, and shall specify the place, the day and the hour of meeting and, in case of special business, the general nature of that business and shall be given, in manner hereinafter mentioned or in such other manner, if any, as may be prescribed by the company

[No. ] The Companies Act, 2004304

in general meeting, to such persons as are, under the articles of the company, entitled to receive such notices from the company:

Provided that a meeting of the company shall, notwithstanding that it is called by shorter notice than that specified in this article be deemed to have been duly called if it is so agreed—

(a) in the case of a meeting called as the annual general meeting, by all the members entitled to attend and vote there at; and

(b) in the case of any other meeting, by a majority in number of the members having a right to attend and vote at the meeting, being a majority together representing not less than ninety-five per cent of the total voting rights at that meeting of all the members.

20. The accidental omission to give notice of a meeting to, or the non-receipt of notice of a meeting by, any person entitled to receive notice shall not invalidate the proceedings at that meeting.

Proceedings at General Meetings

21. All business shall be deemed special that is transacted at an extraordinary general meeting, and also all that is transacted at an annual general meeting, with the exception of declaring a dividend, the consideration of the accounts, balance sheets, and the reports of the directors and auditors, the election of directors in the place of those retiring and the appointment of, and the fixing of the remuneration, of the auditors.

22. No business shall be transacted at any general meeting unless a quorum of members is present at the time when the meeting proceeds to business; save as herein otherwise provided, three members present in person shall be a quorum.

23. If within half an hour from the time appointed for the meeting a quorum is not present, the meeting, if convened upon the requisition of members, shall be dissolved; in any other case it shall stand adjourned to the same day in the next week, at the same time and place, or to such other day and at such other time and place as the directors may determine, and if at the adjourned meeting a quorum is not present within half an hour from the time appointed for the meeting the members present shall be a quorum.

24. The chairman, or any, of the board of directors shall preside as chairman at every general meeting of the company, or if there is no such chairman, or if he shall not be present within fifteen minutes after the time appointed for the holding of the meeting or is unwilling to act the directors present shall elect one of their number to be chairman of the meeting.

25. If at any meeting no director is willing to act as chairman or if no director is present with in fifteen minutes after the time appointed for holding the meeting,

305The Companies Act, 2004 [No. ]

the members present shall choose one of their number to be chairman of the meeting.

26. The chairman may, with the consent of any meeting at which a quorum is present (and shall if so directed by the meeting), adjourn the meeting from time to time and from place to place, but no business shall be transacted at any adjourned meeting other than the business left unfinished at the meeting from which the adjournment took place. When a meeting is adjourned for thirty days or more, notice of the adjourned meeting shall be given as in the case of an original meeting. Save as aforesaid it shall not be necessary to give any notice of an adjournment or of the business to be transacted at an adjourned meeting.

27. At any general meeting a resolution put to the vote of the meeting shall be decided on a show of hands unless a poll is (before or on the declaration of the result of the show of hands) demanded—

(a) by the chairman; or

(b) by at least three members present in person or by proxy; or

(c) by any member or members present in person or by proxy and representing not less than one-tenth of the total voting rights of all the members having the right to vote at the meeting.

Unless a poll be so demanded a declaration by the chairman that a resolution has on a show of hands been carried or carried unanimously, or by a particular majority, or lost and an entry to that effect in the book containing the minutes of proceedings of the company shall be conclusive evidence of the fact without proof of the number or proportion of the votes recorded in favour of or against such resolution.

The demand for a poll may be withdrawn.

28. Except as provided in article 30, if a poll is duly demanded it shall be taken in such manner as the chairman directs, and the result of the poll shall be deemed to be the resolution of the meeting at which the Poll was demanded.

29. In the case of an equality of votes, whether on a show of hands or on a poll, the chairman of the meeting at which the show of hands takes place or at which the poll is demanded, shall be entitled to a second or casting vote.

30. A poll demanded on the election of a chairman, or on a question of adjournment, shall be taken forthwith. A poll demanded on any other question shall be taken at such time as the chairman of the meeting directs, and any business other than that upon which a poll has been demanded may be proceeded with pending the taking of the poll.

31. Subject to the provisions of the Act a resolution in writing signed by all the members for the time being entitled to receive notice of and to attend and

[No. ] The Companies Act, 2004306

vote at general meetings (or being corporations by their duly authorized representatives) shall be as valid and effective as if the same had been passed at a general meeting of the company duly convened and held.

Votes of Members

32. Every member shall have one vote.

33. A member of unsound mind, or in respect of whom an order has been made by any court having jurisdiction in lunacy, may vote, whether on a show of hands or on a poll, by his committee, receiver or other person in the nature of a committee, or receiver, appointed by that court, and any such committee, receiver or other person may, on a poll, vote by proxy.

34. No member shall be entitled to vote at any general meeting unless all moneys presently payable by him to the company have been paid.

35. On a poll votes may be given either personally or by proxy.

36. The instrument appointing a proxy shall be in writing under the hand of the appointer or of his attorney duly authorized in writing, or, if the appointer is a corporation, either under seal or under the hand of an officer or attorney duly authorized. A proxy need not be a member of the company.

37. The instrument appointing a proxy and the power of attorney or other authority, if any, under which it is signed or a notarially certified copy of that power or authority shall be deposited at the registered office of the company or at such other place within the Island as is specified for that purpose in the notice convening the meeting, not less than 48 hours before the time for holding the meeting or adjourned meeting at which the person named in the instrument proposes to vote, or, in the case of a poll, not less than 24 hours before the time appointed for the taking of the poll, and in default the instrument of proxy shall not be treated as valid.

38. An instrument appointing a proxy shall be in the following form or a form as near thereto as circumstances admit—

Company Limited.

I/We , of , being a member/

members of the abovenamed company, hereby appoint of

, or failing him of

as my/our proxy to vote for me/us on my/our behalf at the [annual or

extraordinary, as the case may be] general meeting of the company to be held

on the day of ,

and at any adjournment thereof.

Signed this day of

307The Companies Act, 2004 [No. ]

39. Where it is desired to afford members an opportunity of voting for or against a resolution the instrument appointing a proxy shall be in the following form or a form as near thereto as circumstances admit—

Company Limited.

I/We , of , being a member/

members of the abovenamed company, hereby appoint of

, or failing him of

, as my/our proxy to vote for me/us on

my/our behalf at the [annual or extraordinary, as the case may be] general

meeting of the company to be held on the day of , and

at any adjournment thereof.

Signed this day of

*used in favour of

This form is to be–———————————————the resolution. Unless

* against

otherwise instructed, the proxy will vote as he thinks fit.

––––––––––––––––––––––––––––––––––

*Strike out whichever is not desired.”

40. The instrument appointing a proxy shall be deemed to confer authority to demand or join in demanding a poll.

41. Avote given in accordance with the terms of an instrument of proxy shall be valid notwithstanding the previous death or insanity of the principal or revocation of the proxy or of the authority under which the proxy was executed, provided that no intimation in writing of such death, insanity or revocation as aforesaid shall have been received by the company at the office before the commencement of the meeting or adjourned meeting at which the proxy is used.

Corporations acting by Representatives at Meetings

42. Any corporation which is a member of the company may by resolution of its directors or other governing body authorize such person as it thinks fit to act as its representative at any meeting of the company, and the person so authorized shall be entitled to exercise the same powers on behalf of the corporation which he represents as that corporation could exercise if it were an individual member of the company.

[No. ] The Companies Act, 2004308

Directors

43. The number of the directors and the names of the first directors shall be determined in writing by the subscribers of the articles or a majority of them.

44. The remuneration of the directors shall from time to time be determined by the company in general meeting. Such remuneration shall be deemed to accrue from day to day. The directors shall also be paid all travelling, hotel and other expenses properly incurred by them in attending and returning from meetings of the directors or any committee of the directors or general meetings of the company or in connection with the business of the company.

Borrowing Powers

45. The directors may exercise all the powers of the company to borrow money, and to mortgage or charge its undertaking and property, or any part thereof, and to issue debentures, debenture stock and other securities, whether outright or as security for any debt, liability or obligation of the company or of any third party.

Powers and Duties of Directors

46. The business of the company shall be managed by the directors who may pay all expenses incurred in promoting and registering the company, and may exercise all such powers of the company as are not, by the Act or by these articles, required to be exercised by the company in general meeting, subject nevertheless to the provisions of theAct or these articles and to such regulations, being not inconsistent with the aforesaid provisions, as may be prescribed by the company in general meeting; but no regulation made by the company in general meeting shall invalidate any prior act of the directors which would have been valid if that regulation had not been made.

47. The directors may from time to time and at any time by power of attorney appoint any company, firm or person or body of persons, whether nominated directly or indirectly by the directors, to be the attorney or attorneys of the company for such purposes and with such powers, authorities and discretions (not exceeding those vested in or exercisable by the directors under these articles) and for such period and subject to such conditions as they may think fit, and any such powers of attorney may contain such provisions for the protection and convenience of persons dealing with any such attorney as the directors may think fit and may also authorize any such attorney to delegate all or any of the powers, authorities and discretions vested in him.

48. All cheques, promissory notes, drafts, bills of exchange and other negotiable instruments, and all receipts for moneys paid to the company, shall be signed, drawn, accepted, endorsed, or otherwise executed, as the case may be, in such manner as the directors shall from time to time by resolution determine.

309The Companies Act, 2004 [No. ]

49. The directors shall cause minutes to be made in books provided for the purpose—

(a) of all appointments of officers made by the directors;

(b) of the names of the directors present at each meeting of the directors and of any committee of the directors;

(c) of all resolutions and proceedings at all meetings of the company, and of the directors, and of committees of directors and every director present at any meeting of directors or committee of directors shall sign his name in a book to be kept for that purpose.

Disqualification of Directors

50. The office of director shall be vacated if the director—

(a) without the consent of the company in general meeting holds any other office of profit under the company; or

(b) becomes bankrupt or makes any arrangement or composition with his creditors generally; or

(c) becomes prohibited from being a director by reason of any order made under sections 180 and 182 of the Act; or

(d) becomes of unsound mind; or

(e) resigns his office by notice in writing to the company; or

(f) is directly or indirectly interested in any contract with the company and fails to declare the nature of his interest in manner required by section 193 of the Act.

A director shall not vote in respect of any contract in which he is interested or any matter arising thereout, and if he does so vote his vote shall not be counted.

Rotation of Directors

51. At the first annual general meeting of the company all the directors shall retire from office, and at the annual general meeting in every subsequent year one-third of the directors for the time being, or, if their number is not three or a multiple of three, then the number nearest one-third, shall retire from office.

52. The directors to retire in every year shall be those who have been longest in office since their last election, but as between persons who became directors on the same day those to retire shall (unless they otherwise agree among themselves) be determined by lot.

53. Aretiring director shall be eligible for re-election.

[No. ] The Companies Act, 2004310

54. The company at the meeting at which a director retires in manner aforesaid may fill the vacated office by electing a person thereto, and in default the retiring director shall, if offering himself for re-election, be deemed to have been re- elected, unless at such meeting it is expressly resolved not to fill such vacated office or unless a resolution for the re-election of such director shall have been put to the meeting and lost.

55. No person other than a director retiring at the meeting shall unless recommended by the directors be eligible for election to the office of director at any general meeting unless, not less than three nor more than twenty-one days before the date appointed for the meeting, there shall have been left at the registered office of the company notice in writing, signed by a member duly qualified to attend and vote at the meeting for which such notice is given, of his intention to propose such person for election, and also notice in writing signed by that person of his willingness to be elected.

56. The company may from time to time by ordinary resolution increase or reduce the number of directors, and may also determine in what rotation the increased or reduced number is to go out of office.

57. The directors shall have power at any time, and from time to time, to appoint any person to be a director, either to fill a casual vacancy or as an addition to the existing directors, but so that the total number of directors shall not at any time exceed the number fixed in accordance with these articles. Any director so appointed shall hold office only until the next following annual general meeting, and shall then be eligible for re-election, but shall not be taken into account in determining the directors who are to retire by rotation at such meeting.

58. The company may by ordinary resolution remove any director before the expiration of his period of office notwithstanding anything in these articles or any agreement between the company and such director. Such removal shall be without prejudice to any claim such director may have for damages for breach of any contract of service between him and the company.

59. The company may by ordinary resolution appoint another person in place of a director removed from office under article 58. Without prejudice to the powers of the directors under article 57 the company in general meeting may appoint any person to be director either to fill a casual vacancy or as an additional director. The person appointed to fill such a vacancy shall be subject to retirement at the same time as if he had become a director on the day on which the director in whose place he is appointed was last elected a director.

Proceedings of Directors

60. The directors may meet together for the despatch of business, adjourn, and otherwise regulate their meetings, as they think fit. Questions arising at any meeting shall be decided by a majority of votes. In the case of an equality of

311The Companies Act, 2004 [No. ]

votes the chairman shall have a second or casting vote. A director may, and the secretary on the requisition of a director shall, at any time summon a meeting of the directors. It shall not be necessary to give notice of a meeting of directors to any director for the time being absent from the Island.

61. The quorum necessary for the transaction of the business of the directors may be fixed by the directors, and unless so fixed shall be two.

62. The continuing directors may act notwithstanding any vacancy in their body, but, if and so long as their number is reduced below the number fixed by or pursuant to the articles of the company as the necessary quorum of directors, the continuing directors or director may act for the purpose of increasing the number of directors to that number, or of summoning a general meeting of the company, but for no other purpose.

63. The directors may elect a chairman of their meetings and determine the period for which he is to hold office; if no such chairman is elected, or if at any meeting the chairman is not present within five minutes after the time appointed for holding the same, the directors present may choose one of their number to be chairman of the meeting.

64. The directors may delegate any of their powers to committees consisting of such member or members of their body as they think fit; any committee so formed shall in the exercise of the powers so delegated conform to any regulations that may be imposed on it by the directors.

65. Acommittee may elect a chairman of its meetings; if no such chairman is elected, or if at any meeting the chairman is not present within five minutes after the time appointed for holding the same, the members present may choose one of their number to be chairman of the meeting.

66. A committee may meet and adjourn as it thinks proper. Questions arising at any meeting shall be determined by a majority of votes of the members present, and in the case of an equality of votes the chairman shall have a second or casting vote.

67. All acts done by any meeting of the directors or of a committee of directors, or by any person acting as a director, shall, notwithstanding that it be afterwards discovered that there was some defect in the appointment of any such director or person acting as aforesaid, or that they or any of them were disqualified, be as valid as if every such person had been duly appointed and was qualified to be a director.

68. A resolution in writing, signed by all the directors for the time being entitled to receive notice of a meeting of the directors, shall be as valid and effectual as if it had been passed at a meeting of the directors duly convened and held.

[No. ] The Companies Act, 2004312

Secretary

69. The secretary shall be appointed by the directors for such term, at such remuneration and upon such conditions as they may think fit; and any secretary so appointed may be removed by them.

70. A provision of the Act or these articles requiring or authorizing a thing to be done by or to a director and the secretary shall not be satisfied by it’s being done by or to the same person acting both as director and as, or in place of, the secretary.

The Seal

71. The directors shall provide for the safe custody of the seal which shall only be used by the authority of the directors or of a committee of the directors authorized by the directors in that behalf, and every instrument to which the seal shall be affixed shall be signed by a director and shall be countersigned by the secretary or by a second director or by some other person appointed by the directors for the purpose.

Accounts

72. The directors shall cause proper books of account to be kept with respect to—

(a) all sums of money received and expended by the company and the matters in respect of which the receipt and expenditure takes place;

(b) all sales and purchases of goods by the company; and

(c) the assets and liabilities of the company.

Proper books shall not be deemed to be kept if they are not kept such books of account as are necessary to give a true and fair view of the state of the company’s affairs and to explain its transactions.

73. The books of account shall be kept at the registered office of the company, or, subject to subsections (3) and (4) of section 144 of the Act, at such other place or places as the directors think fit, and shall always be open to the inspection of the directors.

74. The directors shall from time to time determine whether and to what extent and at what times and places and under what conditions or regulations the accounts and books of the company or any of them shall be open to the inspection of members not being directors, and no member (not being a director) shall have any right of inspecting any account or book or document of the company except as conferred by statute or authorized by the directors or by the company in general meeting.

313The Companies Act, 2004 [No. ]

75. The directors shall from time to time, in accordance with sections 145 and 147 of theAct, cause to be prepared and to be laid before the company in general meeting such profit and loss accounts, balance sheets, group accounts (if any) and reports as are referred to in those sections.

76. Acopy of every balance sheet (including every document required by law to be annexed thereto) which is to be laid before the company in general meeting, together with a copy of the auditor’s report, shall not less than twenty-one days before the date of the meeting be sent to every member of, and every holder of debentures of, the company.

Provided that this article shall not require a copy of those documents to be sent to any person of whose address the company is not aware or to more than one of the joint holders of any debentures.

Audit

77. Auditors shall be appointed and their duties regulated in accordance with sections 154 to 157 of the Act.

Notices

78. A notice may be given by the company to any member either personally or by sending it by post to him or to his registered address, or (if he has no registered address within the Island) to the address, if any, within the Island supplied by him to the company for the giving of notice to him. Where a notice is sent by post, service of the notice shall be deemed to be effected by properly addressing, pre-paying and posting a letter containing the notice, and to have been effected in the case of a notice of a meeting at the expiration of 24 hours after the letter containing the same is posted, and in any other case at the time at which the letter would be delivered in the ordinary course of post.

79. Notice of every general meeting shall be given in any manner hereinbefore authorized to—

(a) every member except those members who (having no registered address within the Island) have not supplied to the company an address within the Island for the giving of notices to them;

(b) every person being a legal personal representative or a trustee in bankruptcy of a member where the member but for his death or bankruptcy would be entitled to receive notice of the meeting; and

(c) the auditor for the time being of the company.

No other person shall be entitled to receive notices of general meetings.

[No. ] The Companies Act, 2004314

TABLE C

Articles of Incorporation of a Company Limited by Guarantee, and having a Share Capital

Form ....................................

THE COMPANIES ACT

ARTICLES OF INCORPORATION

(Company Limited by Guarantee with Share Capital Pursuant to section 20 (2))

1. Name of Company...............................................................................................

2. Situation of RegisteredOffice..............................................................................

3. Main Business of Company..............................................................................

.............................................................................................................................

4. a. State proposed number of members at time of

registration.................................................................................................

b. State terms of undertaking and extent of Guarantee

.....................................................................................................................

5. Form of Company

Private Public

6. Share Capital .......................................................................................................

7. Classes of Shares and any maximum number of shares the company is authorized to issue............................................................................................

8. Restictions, if any on Share Transfer or Share Ownership:

.............................................................................................................................

9. Pre-emptive Rights Granted Yes No

If yes, indicate nature of rights granted with any variation, if any:

.....................................................................................................................................

......................................................................................................................................

10. Rights, Privileges, Restrictions and conditions (if any) attaching to each class of shares and Directors authority with respect to any class of shares which may be issued:

11. Articles set forth in Table C and D of the First Schedule are adopted.

12. Restrictions, if any on Powers to Amend Articles:

..........................................................................................................................................

...........................................................................................................................................

315The Companies Act, 2004 [No. ]

13. Number (or minimum/maximum) (number) of Directors:

...........................................................................................................................................

...........................................................................................................................................

14. Indicate Name(s) of First Directors for the time being if any:

..............................................................................................................................................

...........................................................................................................................................

15. Restrictions, on business the company may carry on (if any):

.............................................................................................................................................

16. Other provisions (if any):

...........................................................................................................................................

The number of members with which the company proposes to be registered is [ ] but the directors may from time to time register an increase of members.

Subscribers Name and Occupation Address Signatures

DATED the..................................... day of............................................. 20.............

Witness to the Signatures of the above subscribers

Signature........................................................................... (Name)

Address............................................................................

Number of shares taken

by each Names, Addresses and Descriptions of Subscribers Subscriber

–––

1. John Jones of merchant 200 2. John Smith of " 25 3. Thomas Green of " 30 4. John Thompson of " 40 5. Caleb White of " 15 6. Andrew Brown of " 5 7. Caesar White of " 10

–––– Total shares taken 325

––––

Dated the day of 20 .

Witness to the above signatures, A.B., No. 13, XYZ Street, Kingston,

Jamaica.

[No. ] The Companies Act, 2004316

TABLE D

Articles of Incorporation of an Unlimited Company having a Share Capital

Form ....................................

THE COMPANIES ACT

ARTICLES OF INCORPORATION OF AN UNLIMITED COMPANY HAVING A SHARE CAPITAL

1. Name of Company.............................................................................................

2. Situation of Registered Office.........................................................................

3. Main Business of Company............................................................................

.............................................................................................................................

4. Form of Company Public

Private

The company is a private company and accordingly—

(a) the right to transfer shares is restricted in manner hereinafter prescribed;

(b) subject to section 25 (1) (b) of theAct, the number of members of the company (exclusive of persons who are in the employment of the company and of persons who having been formerly in the employment of the company were while in such employment and have continued after the determination of such employment to be members of the company) is limited to twenty:

Provided that where two or more persons hold one or more shares in the company jointly they shall for the purpose of this regulation be treated as a single member;

(c) any invitation to the public to subscribe for any shares or debentures of the company is prohibited;

(d) any invitation to the public to deposit money for fixed periods or payable on call whether bearing or not bearing interest is prohibited;

(e) subject to the exceptions provided for in the Twelfth Schedule any person other than the holder is prohibited from having any interest in any of the company’s shares; and

(f) the company shall not have power to issue share warrants to bearer.

317The Companies Act, 2004 [No. ]

5. The number of members with which the company proposes to be registered is [ ], but the directors may from time to time register an increase of members.

6. The company may by special resolution—

(a) increase the share capital by such amount as the resolution may prescribe;

(b) increase the number of its shares;

(c) reduce the number of its shares;

(d) cancel any shares which at the date of the passing of the resolution have not been taken or agreed to be taken by any person;

(e) reduce its share capital in any way.

7. The articles in Table A, set out in the First Schedule (other than articles [ ] to [ ] inclusive), shall be deemed to be incorporated with these articles and shall apply to the company.

Name and Occupation Address Signatures

DATED the......................................... day of............................................... ...........

WITNESS TO THE SIGNATURES OF THE ABOVE SUBSCRIBERS

Signature.................................................................. (Name)

Address.....................................................................

[No. ] The Companies Act, 2004318

SECOND SCHEDULE (Section 26)

Form of Statement in lieu of Prospectus to be delivered to Registrar by a Private Company on becoming a Public Company and Reports to be set out

therein

PART I

Form of Statement and Particulars to be contained therein

THE COMPANIES ACT

Statement in lieu of Prospectus delivered for registration by

[Insert the name of the company]

Pursuant to section 26 of the Companies Act

Delivered for registration by The share capital of the company $

Amount (if any) of above capital which consists of redeemable preference shares.

The date on or before which these shares are, or are liable, to be redeemed.

Names, descriptions and addresses of directors or proposed directors.

Amount of shares issued ... Shares

Amount of commissions paid in connection therewith.

Unless more than one year has elapsed since the date on which the Company was entitled to commence business—

Amount of preliminary expenses ... $ Name of promoter—

Amount paid to any promoter ... Amount $

Consideration for the payment ... Consideration—

Any other benefit given to any promoter Name of promoter Nature of value of benefit—

Consideration for giving of benefit ... Consideration—

319The Companies Act, 2004 [No. ]

If the share capital of the company is divided into different classes of shares, the right of voting at meetings of the company conferred by, and the rights in respect of capital and dividends attached to, the several classes of shares respectively.

Number and amount of shares and debentures issued within the two years preceding the date of this statesment as fully or partly paid up otherwise than for cash or agreed to be so issued at the date of this statement.

Consideration for the issue of those shares or debentures ...

Number, description and amount of any shares or debentures which any person has or is entitled to be given an option to subscribe for, or to acquire from a person to whom they have been allotted or agreed to be allotted with a view to his offering them for sale.

Period during which option is exercisable

Price to be paid for shares or debentures subscribed for or acquired under option.

Consideration for option or right to option ...

Persons to whom option or right to option was given or, if given to existing shareholders or debenture holders as such, the relevant shares or debentures.

Names and addresses of vendors of property (1) purchased or acquired by the company within the two years preceding the date of this statement or (2) agreed or proposed to be purchased or acquired by the company except where the contract for its purchase or acquisition was entered into in the ordinary course of business and there is no connection between the contract and

debenture $ Consideration—

––––––Shares of $.......................

and ......................Debentures of $...............................

Until

Consideration—

Names and Addresses—

[No. ] The Companies Act, 2004320

the company ceasing to be a private company or where the amount of the purchase money is not material.

Amount (in cash, shares or debentures) paid or payable to each separate vendor.

Amount paid or payable in cash, shares or debentures for any such property specifying the amount paid or payable for goodwill. ...

Short particulars of any transaction relating to any such property which was completed within the two preceding years and in which any vendor to the company or any person who is, or was at the time thereof, a promoter, director or proposed director of the company had any interest direct or indirect.

Dates of, parties to, and general nature of every material contract (other than contracts entered into in the ordinary course of business or entered into more than two years before the delivery of this statement).

Time and place at which the contracts or copies thereof may be inspected.

Names and addresses of the auditors of the company.

Full particulars of the nature and extent of the interest of every director in any property purchased or acquired by the company within the two years preceding the date of this statement or proposed to be purchased or acquired by the company or, where the interest of such a director consists in being a partner in a firm, the nature and extent of the interest of the firm, with a statement of all sums paid or agreed to be paid to him or to the firm in cash or shares, or otherwise, by any person either to induce him to become or to qualify him

Total purchase price $ Cash ... $ Shares ... $ Debenture ... $ Goodwill ... $

321The Companies Act, 2004 [No. ]

as a director, or otherwise for services rendered or to be rendered to the company by him or by the firm.

Rates of the dividends (if any) paid by the company in respect of each class of shares in the company in each of the three financial years immediately preceding the date of this statement or since the incorporation of the company whichever period is the shorter.

Particulars of the cases in which no dividends have been paid in respect of any class of shares in any of these years.

Signatures of the persons abovenamed as directors or proposed directors or of their agents authorized in writing.

___________________________

___________________________

___________________________

Date:___________________

PART II

Reports to be Set Out

1. If unissued shares or debentures of the company are to be applied in the purchase of a business, a report made by accountants (who shall be named in the statement) upon—

(a) the profits or losses of the business in respect of each of the three financial years immediately preceding the delivery of the statement to the Registrar; and

(b) the assets and liabilities of the business at the last date to which the accounts of the business were made up.

2.—(1) If unissued shares or debentures of the company are to be applied directly or indirectly in any manner resulting in the acquisition of shares in a body corporate which by reason of the acquisition or anything to be done in consequence thereof or in connection therewith will become a subsidiary of the company, a report made by accountants (who shall be named in the statement) with respect to the profits and losses and assets and liabilities of the other body corporate in accordance with sub-paragraph (2) or (3) as the case requires, indicating how the profits or losses of the other body corporate dealt with by the report would, in respect of the shares to be acquired, have concerned members

[No. ] The Companies Act, 2004322

of the company, and what allowance would have fallen to be made, in relation to assets and liabilities so dealt with, for holders of other shares, if the company had at all material times held the shares to be acquired.

(2) If the other body corporate has no subsidiaries, the report referred to in sub-paragraph (1) shall—

(a) so far as regards profits and losses, deal with the profits or losses of the body corporate in respect of each of the three financial years immediately preceding the delivery of the statement to the Registrar; and

(b) so far as regards assets and liabilities, deal with the assets and liabilities of the body corporate at the last date to which the accounts of the body corporate were made up.

(3) If the other body corporate has subsidiaries, the report referred to in the said sub-paragraph (1) shall—

(a) so far as regards profits and losses, deal separately with the other body corporate’s profits or losses as provided by sub-paragraph (2) and in addition deal either—

(i) as a whole with the combined profits or losses of its subsidiaries, so far as they concern members of the other body corporate; or

(ii) individually with the profits or losses of each subsidiary, so far as they concern members of the other body corporate,

or, instead of dealing separately with the other body corporate’s profits or losses, deal as a whole with the profits or losses of the other body corporate and, so far as they concern members of the other body corporate, with the contained profits or losses of its subsidiaries; and

(b) so far as regards assets and liabilities, deal separately with the other body corporate’s assets and liabilities as provided by sub-paragraph (2) and, in addition, deal either—

(i) as a whole with the combined assets and liabilities of its subsidiaries, with or without the other body corporate’s assets and liabilities; or

(ii) individually with the assets and liabilities of each subsidiary,

and shall indicate as respects the assets and liabilities of the subsidiaries the allowance to be made for persons other than members of the company.

323The Companies Act, 2004 [No. ]

PART III

Provisions applying to Parts I and II of this Schedule

3. In this Schedule the expression “vendor” includes a vendor as defined in Part I of the Third Schedule and the expression “financial year” has the meaning assigned to it in that Part II of that Schedule.

4. If in the case of a business which has been carried on, or of a body corporate which has been carrying on business, for less than three years, the accounts of the business or body corporate have only been made up in respect of two years or one year, Part II shall have effect as if references to two years or one year, as the case may be, were substituted for references to three years.

5. Any report required by Part II shall either indicate by way of note any adjustments as respects the figures of any profits or losses or assets and liabilities dealt with by the report which appear to the persons making the report necessary or shall make those adjustments and indicate that adjustments have been made.

6. Any report by accountants required by Part II shall be made by accountants qualified under this Act for appointment as auditors of a company and shall not be made by any accountant who is an officer or servant or, except where the company is a private company, a person who is a partner of or in the employment of an officer or servant of the company; and for the purposes of this paragraph the expression “officer” shall include a proposed director but not an auditor.

THIRD SCHEDULE (Sections 26, 41, 47, 48, 49, 372 and 373)

Matters to be specified in Prospectus and Reports to be set out therein

PART I

Matters to be specified

The company’s proprietorship, management and its capital requirements.

1.—(1) The prospectus must state—

(a) the number of founders or management or deferred shares, if any, and the nature and extent of the interest of the holders in the property and profits of the company;

(b) the number of shares, if any, fixed by the articles as the qualification of a director, and any provision in the articles as to the remuneration of the directors;

(c) the names, descriptions and addresses of the directors or proposed directors.

[No. ] The Companies Act, 2004324

(2) Sub-paragraphs (1)(b) and (1)(c) do not apply in the case of a prospectus issued more than 2 years after the date at which the company is entitled to commence business.

2. Where shares are offered to the public for subscription, particulars as to—

(a) the minimum amount which, in the opinion of the directors must be raised by the issue of those shares in order to provide the sums, or, if any part thereof is to be defrayed in any other manner, the balance of the sums, required to be provided in respect of each of the following matters—

(i) the purchase price of any property purchased or to be purchased which is to be defrayed in whole or in part out of the proceeds of the issue;

(ii) any preliminary expenses payable by the company, and any commission so payable to any person in consideration of his agreeing to subscribe for, or of his procuring or agreeing to procure subscriptions for, any shares in the company;

(iii) the repayment of any moneys borrowed by the company in respect of any of the foregoing matters;

(iv) working capital; and

(b) the amounts to be provided in respect of the matters aforesaid otherwise than out of the proceeds of the issue and the sources out of which those amounts are to be provided.

Details relating to the offer

3.—(1) The prospectus must state—

(a) the time of the opening of the subscription lists;

(b) the amount payable on application and allotment on each share (including the amount, if any payable by way of premium).

(2) In the case of a second or subsequent offer of shares, the amount offered for subscription on each previous allotment made within the two preceding years, the amount actually allotted and the amount if any, paid on the shares so allotted.

4.—(1) There must be stated the number, description and amount of any shares in or debentures of the company which any person has, or is entitled to be given, an option to subscribe for.

325The Companies Act, 2004 [No. ]

(2) The following particulars of the option must be given—

(a) the period during which it is exercisable;

(b) the price to be paid for shares or debentures subscribed for under it;

(c) the consideration (if any) given or to be given for it or for the right to it;

(d) the names and addresses of the persons to whom it or the right to it was given or, if given to existing shareholders or debenture holders as such, the relevant shares or debentures.

(3) References in this paragraph to subscribing for shares or debentures include acquiring them from a person to whom they have been allotted with a view to his offering them for sale.

5.—(1) There shall be shown under separate headings—

(a) the aggregate amounts respectively of the company's trade investments, quoted investments other than trade investments and unquoted investments other than trade investments;

(b) if the amount of the goodwill and of any patents and trade marks or part of that amount is shown as a separate item in or is otherwise ascertainable from the books of the company, or from any contract for the sale or purchase of any property to be acquired by the company, or from any documents in the possession of the company relating to the stamp duty payable in respect of any such contract or the conveyance of any such property, the said amount so shown or ascertained so far as not written off or, as the case may be, the said amount so far as it is shown or ascertainable and as so shown or ascertained, as the case may be;

(c) the aggregate amount of bank loans and overdrafts;

(d) the net aggregate amount (after deduction of income tax) which is recommended for distribution by way of dividend.

(2) Nothing under heading (b) of sub-paragraph (1) shall be taken as requiring the amount of the goodwill, patents and trade marks to be stated otherwise than as a single item.

(3) The heading showing the amount of the quoted investments other than trade investments shall be subdivided, where necessary, to distinguish the investments as respects which there has, and those as respects which there has not, been granted a quotation or permission to deal on a recognized stock exchange.

[No. ] The Companies Act, 2004326

6.—(1) For the purposes of paragraphs 7 and 8 relevant property is property purchased or acquired by the company, or proposed so to be purchased or acquired—

(a) which is to be paid for wholly or partly out of the proceeds of the issue offered for subscription by the prospectus; or

(b) the purchase or acquisition of which has not been completed at the date of the issue of the prospectus.

(2) Paragraphs 7 and 8 do not apply to property—

(a) the contract for the purchase or acquisition of which was entered into in the ordinary course of the company’s business, not being a contract made in contemplation of the issue nor the issue in contemplation of the contract; or

(b) as respects which the amount of the purchase money is not material.

7.—(1) As respects any property to which this paragraph applies the prospectus must state—

(a) the names and addresses of the vendors;

(b) the amount payable in cash, shares or debentures to the vendor and, where there is more than one separate vendor, or the company is a sub-purchaser, the amount so payable to each vendor;

(c) short particulars of any transaction relating to the property completed within the two preceding years in which any vendor of the property to the company or any person who is, or was at the time of the transaction, a promoter or a director or proposed director of the company had any interest direct or indirect.

8. There must be stated the amount, if any, paid or payable as purchase money in cash, shares or debentures for any relevant property, specifying the amount, if any, payable for goodwill.

9.—(1) The following applies for the interpretation of paragraphs 6,7 and 8.

(2) Every person is deemed a vendor who has entered into any contract (absolute or conditional) for the sale or purchase, or for any option of purchase, of any property to be acquired by the company, in any case where—

(a) the purchase money is not fully paid at the date of the issue of the prospectus;

(b) the purchase money is to be paid or satisfied wholly or in part out of the proceeds of the issue offered for subscription by the prospectus;

327The Companies Act, 2004 [No. ]

(c) the contract depends for its validity or fulfilment on the result of that issue.

(3) Where any property to be acquired by the company is to be taken on lease, paragraphs 6, 7 and 8 apply as if “vendor” included the lessor, “purchase money” included the consideration for the lease and “sub-purchaser” included a sub-lessee.

(4) For the purposes of paragraph 7, where the vendors or any of them are a firm, the members of the firm are not to be treated as separate vendors.

Commissions, Preliminary Expenses, etc.

10.—(1) The prospectus must state—

(a) the amount, if any, paid within the two preceding years, or payable, as commission (but not including commission to sub-underwriters) for subscribing or agreeing to subscribe, or procuring or agreeing to procure subscriptions, for any shares in or debentures of the company, or the rate of any such commission;

(b) the amount or estimated amount of any preliminary expenses and the persons by whom any of those expenses have been paid or are payable, and the amount of estimated amount or the expenses of the issue and the persons by whom any of those expenses have been paid or are payable;

(c) any amount or benefit paid or given within the two preceding years or intended to be paid or given to any promoter, and the consideration for the payment or the giving of the benefit.

(2) Sub-paragraph (1) (b), so far as it relates to preliminary expenses, does not apply in the case of a prospectus issued more than 2 years after the date at which the company is entitled to commence business.

Contracts

11.—(1) The prospectus must give the dates of, parties to, and general nature of every material contract.

(2) Sub-paragraph (1) does not apply to a contract entered into in the ordinary course of the business carried on or intended to be carried on by the company or a contract entered into more than two years before the date of issue of the prospectus.

Auditors

12. The prospectus must state the names and addresses of the company’s auditors, if any.

[No. ] The Companies Act, 2004328

Interests of Directors

13.—(1) The prospectus must give full particulars of—

(a) the nature and extent of the interest, if any, of every director in the promotion of, or in the property proposed to be acquired by, the company; or

(b) where the interest of such a director consists in being a partner in a firm, the nature and extent, of the interest of the firm.

(2) The particulars required under sub-paragraph (1)(b) must be accompanied by a statement of all sums paid or agreed to be paid to the director or to the firm in cash or shares or otherwise by any person either to induce him to become, or to qualify him as, a director, or otherwise for services rendered by him or by the firm in connection with the promotion or formation of the company.

(3) This paragraph does not apply in the case of a prospectus issued more than 2 years after the date at which the company is entitled to commence business.

Other Matters

14. If the prospectus invites the public to subscribe for shares in the company and the share capital of the company is divided into different classes of shares, the right of voting at meetings of the company conferred by, and the rights in respect of capital and dividends attached to, the several classes of shares respectively.

15. In the case of a company which has been carrying on business, or of a business which has been carried on for less than three years, the prospectus must state the length of time during which the business of the company or the business to be acquired, as the case may be, has been carried on.

329The Companies Act, 2004 [No. ]

PART II

Auditors’ and Accountants’ Reports to be set out in prospectus Auditors’Report

16.—(1) The prospectus shall set out a report by the company’s auditors with respect to—

(a) profits and losses and assets and liabilities, in accordance with sub- paragraph (2) or (3) as the case requires; and

(b) the rates of the dividends, if any, paid by the company in respect of each class of shares in the company in respect of each of the five financial years immediately preceding the issue of the prospectus, giving particulars of each such class of shares on which such dividends have been paid and particulars of the cases in which no dividends have been paid in respect of any class of shares in respect of any of those years, and, if no accounts have been made up in respect of any part of the period of five years ending on the date three months before the issue of the prospectus, containing a statement of the fact.

(2) If the company has no subsidiaries, the report shall—

(a) deal with profits and losses, of the company in respect of each of the five financial years immediately preceding the issue of the prospectus; and

(b) deal with the assets and liabilities of the company at the last date to which the accounts of the company were made up.

(3) If the company has subsidiaries, the report shall—

(a) deal separately with the company’s profits or losses as provided by sub-paragraph (2), and in addition, deal either—

(i) as a whole with the combined profits or losses of its subsidiaries, so far as they concern members of the company; or

(ii) individually with the profits or losses of each subsidiary so far as they concern members of the company,

or, instead of dealing separately with the company’s profits or losses, deal as a whole with the profits or losses of the company and, so far as they concern members of the company, with the combined profits or losses of its subsidiaries; and

(b) deal separately with the company’s assets and liabilities as provided by sub-paragraph (2) and, in addition, deal either—

(i) as a whole with the combined assets and liabilities of its subsidiaries, with or without the company’s assets and liabilities; or

(ii) individually with the assets and liabilities of each subsidiary,

indicating, as respects the assets and liabilities of the subsidiaries the allowance to be made for persons other than members of the company.

[No. ] The Companies Act, 2004330

Accountants' Reports

17. If the proceeds of the issue of the shares or debentures are to be applied directly or indirectly in the purchase of any business, or any part of the proceeds of the issue is to be so applied, there shall be set out in the prospectus a report made by accountants upon—

(a) the profits or losses of the business in respect of each of the five financial years immediately preceding the issue of the prospectus; and

(b) the assets and liabilities of the business at the last date to which the accounts of the business were made up.

18.—( 1) The following provisions apply if—

(a) the proceeds of the issue are to be applied directly or indirectly in any manner resulting in the acquisition by the company of shares in any other undertaking, or any part of the proceeds is to be so applied; and

(b) by reason of that acquisition or anything to be done in consequence thereof or in connection therewith that undertaking will become a subsidiary of the company.

(2) There shall be set out in the prospectus a report made by accountants upon—

(a) the profits or losses of the other undertaking in respect of each of the five financial years immediately preceding the issue of the prospectus; and

(b) the assets and liabilities of the other undertaking at the last date to which its accounts were made up.

(3) The report shall—

(a) indicate how the profits or losses of the other body corporate dealt with by the report, would, in respect of the shares to be acquired, have concerned members of the company and what allowance would have fallen to be made, in relation to assets and liabilities so dealt with, for holders of other shares if the company had at all material times held the shares to be acquired; and

(b) where the other undertaking is a parent undertaking, deal with the profits or losses and the assets and liabilities of the undertaking and its subsidiaries in the manner provided by sub-paragraph (3) of paragraph 16 in relation to the company and its subsidiaries.

331The Companies Act, 2004 [No. ]

Provisions interpreting preceding paragraphs and modifying them in certain cases

19. If in the case of a company which has been carrying on business, or of a business which has been carried on, for less than five years, the accounts of the company or business have only been made up in respect of four years, three years or one year, the preceding paragraphs of this Part shall have effect as if references to four years, three years or one year, as the case may be, were substituted for references to five years.

20. The expression “financial year” in Part II means the year in respect of which the accounts of the company or of the business, as the case may be, are made up, and where by reason of any alteration of the date on which the financial year of the company or business terminates the accounts of the company or business have been made up for a period greater or less than a year, that greater or less period shall for the purpose of this Part be deemed to be a financial year.

21. Any report required by this Part shall either indicate by way of note any adjustments as respects the figures of any profits or losses or assets and liabilities dealt with by the report which appear to the persons making the report necessary or shall make those adjustments and indicate that adjustments have been made.

22.—(1) Areport required by paragraph 17 or 18 shall be made by accountants qualified under this Act for appointment as auditors of a company.

(2) Such a report shall not be made by any accountant who is an officer or servant or partner of or in the employment of an officer or servant of—

(a) the company or any of its subsidiaries;

(b) a parent undertaking of the company or any subsidiary of such an undertaking.

(3) The accountants making any report required for purposes of paragraph 17 or 18 shall be named in the prospectus.

FOURTH SCHEDULE (Section 49)

Form of Statement in lieu of Prospectus to be delivered to Registrar by a Company which does not issue a Prospectus or which does not go to Allotment on a Prospectus issued, and Reports to be set out therein

PART I

Form of Statement and Particulars to be contained therein

The Companies Act

Statement in lieu of Prospectus delivered for registration by

[Insert the name of the company]

Pursuant to section 49 of the Companies Act.

[No. ] The Companies Act, 2004332

Delivered for registration by

The share capital of the company

Amount (if any) of above capital which consists of redeemable preference shares.

The earliest date on which the company has power to redeem these shares.

Names, descriptions and addresses of directors or proposed directors.

If the share capital of the company is divided into different classes of shares, the right of voting at meetings of the company conferred by, and the rights in respect of capital and dividends attached to, the several classes of shares respectively.

Number and amount of shares and debentures agreed to be issued as fully or partly paid up otherwise than in cash.

The consideration for the intended issue of those shares and debentures.

Number, description and amount of any shares or debentures which any person has or is entitled to be given an option to subscribe for, or to acquire from a person to whom they have been allotted or agreed to be allotted with a view to his offering them for sale.

Period during which option is exercisable.

Price to be paid for shares or debentures subscribed for or acquired under option.

Consideration for option or right to option.

Persons to whom option or right to option was given or, if given to existing shareholders or debenture holders as such, the relevant shares or debentures.

debenture

$

Consideration

Share of $

and Debentures

of $

Until

Consideration:

Names and Addresses:—

333The Companies Act, 2004 [No. ]

Names and addresses of vendors of property purchased or acquired, or proposed to be purchased or acquired by the company except where the contract for its purchase or acquisition was entered into in the ordinary course of the business intended to be carried on by the company or the amount of the purchase money is not material.

Amount (in cash, shares or debentures) payable to each separate vendor.

Amount (if any) paid or payable (in cash or shares or debentures) for any such property, specifying amount (if any) or payable for goodwill.

Short particulars of any transaction relating to such property which was complete within the two preceding years and in which any vendor to the company or any person who is, or was at the time thereof, a promoter, director or proposed director of the company had any interest direct or indirect.

Amount (if any) paid or payable as commission for subscribing or agreeing to subscribe or procuring or agreeing to procure subscriptions for any shares or debentures in the company; or

Rate of the commission ... ...

The number of shares, if any, which persons have agreed for a commission to subscribe absolutely.

Estimated amount of preliminary expenses.

By whom those expenses have been paid or are payable.

Amount paid or intended to be paid to any promoter ...

Consideration for the payment ...

Total purchase price $ Cash ... $ , Shares ... $ Debentures ... $

–––––––– Goodwill $

––––––––

Amount paid. Amount payable.

Rate per centum

$

Name of promoter. Amount $

Consideration:—

[No. ] The Companies Act, 2004334

Any other benefit given or intended to be given to any promoter ...

Consideration for giving of benefit ...

Dates of, parties to, and general nature of, every material contract (other than contracts entered into in the ordinary course of the business intended to be carried on by the company or entered into more than two years before the delivery of this statement).

Time and place at which the contracts or copies thereof may be inspected.

Names and addresses of the auditors of the company (if any).

Full particulars of the nature and extent of the interest of every director in the promotion of or in the property proposed to be acquired by the company, or where the interest of such a director consists in being a partner in a firm, the nature and extent of the interest of the firm, with a statement of all sums paid or agreed to be paid to him or to the firm in cash or shares, or otherwise, by any person either to induce him to become, or to qualify him as, a director, or otherwise for services rendered by him or by the firm in connection with the promotion or formation of the company.

(Signatures of the persons above named as directors or proposed directors, or of their agents authorized in writing).

Date ..................................................

......................................

......................................

Name of promoter:— Nature and value of benefit:—

Consideration:—

PART II

Reports to be Set Out

1. Where it is proposed to acquire a business, a report made by accountants (who shall be named in the statement) upon—

(a) the profits or losses of the business in respect of each of the three financial years immediately preceding the delivery of the statement to the Registrar; and

335The Companies Act, 2004 [No. ]

(b) the assets and liabilities of the business at the last date to which the accounts of the business were made up.

2.—(1) Where it is proposed to acquire shares in an undertaking which by reason of the acquisition or anything to be done in consequence thereof or in connection therewith will become a subsidiary of the company, a report made by accountants (who shall be named in the statement) with respect to the profits and losses and assets and liabilities of the other undertaking in accordance with sub-paragraph (2) or (3) as the case requires, indicating how the profits or losses of the other body corporate dealt with by the report would, in respect of the shares to be acquired, have concerned members of the company and what allowance would have fallen to be made, in relation to assets and liabilities so dealt with, for holders of other shares, if the company had at all material times held the shares to be acquired.

(2) If the other undertaking has no subsidiaries, the report referred to in sub-paragraph (1) shall—

(a) so far as regards profits and losses, deal with the profits or losses of the undertaking in respect of each of the three financial years immediately preceding the delivery of the statement to the Registrar; and

(b) so far as regards assets and liabilities, deal with the assets and liabilities of the undertaking at the last date to which the accounts of the undertaking were made up.

(3) If the other body corporate has subsidiaries, the report referred to in sub-paragraph (1) shall—

(a) so far as regards profits and losses, deal separately with the other undertaking’s profits or losses as provided by sub-paragraph (2), and in addition deal either—

(i) as a whole with the combined profits or losses of its subsidiaries, so far as they concern members of the other undertaking; or

(ii) individually with the profits or losses of each subsidiary, so far as they concern members of the other undertaking,

or, instead of dealing separately with the other undertaking’s profits or losses, deal as a whole with the profits or losses of the other undertaking and, so far as they concern members of the other undertaking, with the combined profits or losses of its subsidiaries; and

[No. ] The Companies Act, 2004336

(b) so far as regards assets and liabilities, deal separately with the other undertaking’s assets and liabilities as provided by sub-paragraph (2) and, in addition, deal either—

(i) as a whole with the combined assets and liabilities of its subsidiaries, with or without the other undertaking’s assets and liabilities; or

(ii) individually with the assets and liabilities of each subsidiary,

and shall indicate as respects the assets and liabilities of the subsidiaries the allowance to be made for persons other than members of the company.

PART III

Provisions Applying to Parts I and II of this Schedule

3. In this Schedule the expression “vendor” includes a vendor as defined in Part I of the Third Schedule, and the expression “financial year” has the meaning assigned to it in Part II of that Schedule.

4. If in the case of a business which has been carried on, or of a body corporate which has been carrying on business, for less than three years, the accounts of the business or body corporate have only been made up in respect of two years or one year, Part II shall have effect as if references to two years or one year, as the case may be, were substituted for references to three years.

5. Any report required by Part II shall either indicate by way of note any adjustments as respects the figures of any profits or losses or assets and liabilities dealt with by the report which appear to the persons making the report necessary or shall make those adjustments and indicate that adjustments have been made.

6. Any report by accountants required by Part II shall be made by accountants qualified under this Act for appointment as auditors of a company and shall not be made by any accountant who is an officer or servant or, except where the company is a private company, a person who is a partner of or in the employment of an officer or servant of the company; and for the purposes of this paragraph the expression “officer” shall include a proposed director but not an auditor.

FIFTH SCHEDULE (Sections 121 and 392)

Contents (Required by section 121 (2)) and form of Annual Return of a Company having a Share Capital

PART I

1. The address of the registered office of the company.

337The Companies Act, 2004 [No. ]

2. If the register of members or the register of debenture holders is under the provisions of thisAct kept elsewhere than at the registered office of the company, the address of the place where such register is kept.

3. A summary, distinguishing between shares issued for cash and shares issued as fully or partly paid up otherwise than in cash, specifying the following particulars—

(a) the amount of the share capital of the company;

(b) the number of shares taken from the commencement of the company up to the date of the return;

(c) the amount called upon each shares;

(d) the total amount of calls received;

(e) the total amount of calls unpaid;

(f) the total amount of shares for which share warrants are outstanding at the date of the return;

(g) the total amount of share warrants issued and surrendered respectively since the date of the last return;

(h) the number of shares comprised in each share warrant.

4. All such particulars with respect to the persons who at the date of the return are the directors of the company as are by thisAct required to be contained with respect to directors in the register of the directors of a company.

5. Particulars of the total amount of the indebtedness of the company in respect of all mortgages and charges which are required to be registered with the Registrar under this Act.

PART II

Form of Annual Return

Annual Return of the Company,

Limited made up to the day of , (being the fourteenth

day after the date of the first or only ordinary general meeting in ).

Address of the registered office of the company

–––––––––––––––––––––––––––––––––––––––––––––––––––––

–––––––––––––––––––––––––––––––––––––––––––––––––––––

Situation of Registers of Members and Debenture holders

Address of place at which register of members is kept if other than the registered office of the Company.

[No. ] The Companies Act, 2004338

Address of place at which register of debenture holders is kept if other than the registered office of the Company.

Summary of Share Capital and Shares

$

$

$

$

$

Issued $ ... ...

Surrendered $ ...

$

Share Capital.

Total number of shares taken up* to the day of , , being

the date of the Return (which number must agree with the total shown in the list as held by existing members).

Number of shares issued subject to payment wholly in cash.

Number of shares issued as fully paid up otherwise than in cash.

Total amount (if any) agreed to be considered as paid on shares which have been issued as fully paid up otherwise than in cash.

Total amount of the sums (if any) paid by way of commission in respect of any shares or debentures or allowed by way of discount in respect of any debenture since the date of the last Return.

Total number of shares forfeited.

Total amount paid (if any) on shares forfeited.

Total amount of shares for which share warrants to bearer are outstanding.

Total amount of share warrants to bearer issued and surrendered respectively since the date of the last Return.

Number of shares comprised in each share warrant to bearer.

Indebtedness

Total amount of the indebtedness of the company in respect of all mortgages and charges of the kind which are required to be registered with the Registrar under the Companies Act.

339The Companies Act, 2004 [No. ]

––––––––––––––––––––––––––––––––––––––––––––––––––––––––––––

* Where there are shares of different kinds e.g., Preference and Ordinary state the number separately.

Include what has been received on forfeited as well as on existing shares.

Copy of last audited Balance Sheet of the Company

In the case of every Company which is not a Private Company and in the case of every Private Company which is obliged to file accounts, this Return must include a written copy, certified by a director or by the Manager or Secretary of the Company to be a true copy, of the last balance sheet which has been audited by the Company’s auditors (including every document required by law to be annexed thereto) together with a copy of the report of the auditors thereon (certified as aforesaid), and if any such balance sheet is in a foreign language there must also be annexed to it a translation thereof in English certified in the prescribed manner to be a correct translation. If the said last balance sheet did not comply with the requirements of the law as in force at the date of the audit with respect to the form of balance sheets there must be made such additions to and corrections in the said copy as would have been required to be made in the said balance sheet in order to make it comply with the said requirements, and the fact that the said copy has been so amended must be stated thereon.

Certificate to be given by Private Company

A. Certificate to be given by every Private Company:—

“We certify that the Company has not since the date of the *last Annual Return issued any invitation to the public to subscribe for any shares or debentures of the Company or to deposit money for fixed periods or payable on call whether bearing or not bearing interest, and we also certify that to the best of our knowledge and belief since the abovementioned date no person other than the holder has, except in cases provided for in the Twelth Schedule, had any interest in any of the Company’s shares”.

Signed ..............................., Director

Signed ..........................., Secretary

B. Should the number of members of the Company exceed twenty, the following certificate is also required:—

“We certify that the excess of members of the Company above twenty consists wholly of persons who are in the employment of the Company and/or of persons who, having been formerly in the employment of the Company, were while in such employment and have continued after the determination of such employment to be, members of the Company”.

[No. ] The Companies Act, 2004340

Signed ..............................., Director

Signed.............................., Secretary

C. Should the company be a private company not obliged to file accounts the following certificate is also required:—

“We certify that to the best of our knowledge and belief, subject to the exceptions provided for in the Thirteenth Schedule, no body corporate holds any shares in the company, and that this has been the position at all times since the date of the *last Annual Return”.

Signed ..............................., Director

Signed.............................., Secretary

NOTE:—Banking companies must add a list of all their places of business.

* In the case of the first Annual Return strike out the words “last Annual Return” and substitute therefor the words “Incorporation of the Company” or in the case of an existing company which became a private company, the date on which it became a private company.

341The Companies Act, 2004 [No. ]

Particulars of the *Directors of the Company, Limited, at the date of the Annual Return

† The present Christian Name or Names and

Surname

Any former Christian Name or Names or Surname

Nationality

Nationality of origin (if other than the present nationality)

Usual residential

address

‡Other business oc- cupation (if

any). If none state so

* “Director” includes any person who occupies the position of a Director by whatever name called and also a shadow director.

† In the case of a Corporation its corporate name and registered or principal office should be shown.

‡ In the case of an individual who has no business occupation but holds any other directorship or directorships particulars of that directorship or of some one of those directorships must be entered.

List of Past and Present Members

List of Persons holding shares in the Company, Limited, on the , and of Persons who have held Shares therein at any time since the date of the last Return, or (in the case of the first Return) of the incorporation of the Company, showing their names, addresses and, occupations, and an Account of the Shares so held.

N.B.—If the names in this list are not arranged in alphabetical order, an index sufficient to enable the name of any person in the list to be readily found must be annexed to this list.

[No. ] The Companies Act, 2004342

..................................................................... Signature

(State whether Director or Manager or Secretary)

*The aggregate Number of Shares held, and not the Distinctive Numbers, must be stated, and the column must be added up throughout so as to make one total to agree with that stated in the Summary to have been taken up.

†When the Shares are of different classes these columns may be subdivided so that the number of each class held, or transferred, may be shown separately. Where any shares have been converted into Stock the amount of Stock held by each member must be shown.

‡The date of Registration of each Transfer should be given as well as the number of Shares transferred on each date. The Particulars should be placed opposite the name of the Transferor and not opposite that of the Transferee, but the name of the Transferee may be inserted in the “Remarks” column immediately opposite the particulars of each Transfer.

The Return must be signed at the end by a Director or by the Manager or Secretary of the Company.

Delivered for filing by

NAMES,ADDRESSES,ANDOCCUPATIONS ACCOUNT OFSHARES

Folio in Register Ledger , contain- ing Par- ticulars

‡ Particulars of Shares

Transferredsince the date of the last Return, or

(in the case of the firstReturn)of

the incorporation of the Company, by persons who

are still Members.

‡ Particulars of Shares

Transferred since the date of the last Return, or (in the case of

the first Return) of the

incorporation of the Company, by

persons who have ceased to be Members.

*Number of Shares held by existing Members at date of Return†

Dateof Registra- tion of

Transfer

Number†Numbers† Dateof

Registra- tion of

Transfer

Occupa- tion

AddressChristian Name

Surname Remarks

343The Companies Act, 2004 [No. ]

SIXTH SCHEDULE (Section 308 (2))

Provisions which do not apply in the case of a winding up subject to supervision of the Court

Section

232. Statement of Company’s affairs to be submitted to Trustee.

233. Report by Trustee.

234. Power of Court to appoint liquidators.

235. Appointment and powers of provisional liquidator.

236. Appointment style, etc., of liquidators.

237. Provisions where person other than Trustee is appointed liquidator.

238. General provisions as to liquidators (except subsection (5)) .

242. Exercise and control of liquidator’s powers.

243. Books to be kept by liquidator in winding up.

244. Payments of liquidator into bank.

245. Audit of liquidator’s accounts.

246. Control of Registrar over liquidators

247. Release of liquidator.

248. Meetings of creditors and contributories to determine whether committee of inspection shall be appointed.

249. Constitution and proceedings of committee of inspection.

250. Powers of Minister where no committee of inspection.

258. Appointment of special manager.

264. Power to order public examination of promoters, directors, etc.

265. Procedure at examination.

268. Delegation to liquidator of certain powers of Court.

342. Power to appoint Trustee as receiver for debenture holders or creditors.

[No. ] The Companies Act, 2004344

SEVENTH SCHEDULE (Sections 53, 149, 152, 157, 159 and 392)

Financial Disclosure—Form and Content of Company Accounts

PART I

Interpretation

1. In this Schedule—

"small company" means a company that qualifies under Part II of this Schedule, to be treated as a small company;

"small group" means a group that qualifies under Part II of this Schedule, to be treated as a small group.

General Rules

2. The accounts referred to in sections 146 (2) and 157 of theAct shall, except as otherwise provided in Part II of this Schedule in relation to small companies or small groups—

(a) be prepared in accordance with generally accepted accounting principles promulgated by the Institute of Chartered Accountants of Jamaica, from time to time, or such other body as the Minister may prescribe;

(b) contain—

(i) a balance sheet;

(ii) a statement of changes in equity;

(iii) a profit and loss account;

(iv) a statement of changes in financial position;

(v) notes to the accounts;

(vi) such other variation or addition to the above list as may be promulgated by the Institute of Chartered Accountants of Jamaica,

but the contents need not be designated by the respective names specified in items (i)—(v).

3. If accounts prepared in accordance with the requirements of paragraph 2 do not (in the opinion of the directors) give a true and fair view of the matters to which they relate, then the directors of the company concerned may depart from those requirements to such extent as may in their opinion be necessary to give a true and fair view of those matters, and particulars of the departure and the reasons for it shall be given in a note to the accounts.

345The Companies Act, 2004 [No. ]

PART II

Small Companies

4.—(1)Asmall company is not required to comply with the generally accepted accounting principles referred to in paragraph 2, unless—

(a) otherwise decided by the directors; or

(b) disqualified under paragraph 8.

(2) The fact of such non-compliance shall be disclosed in notes to the accounts.

5. A small company shall present accounts in accordance with accounting principles that are appropriate to its circumstances having regard to the requirement for those accounts to present a true and fair view of the state of affairs and the results of operation of the company.

6. Acompany shall be treated as qualifying as small in relation to a financial year if it is not disqualified under paragraph 8 or 12, and meets two or more of the criteria specified in paragraph 7—

(a) in the current year, if that is the first financial year of the company;

(b) in the current year and the immediately preceding financial year.

7. The criteria referred to in paragraph 6 in relation to a small company are that—

(a) its turnover is less than $40 million;

(b) its balance sheet total is less than $30 million;

(c) the total number of employees is less than 25.

8. A small company is disqualified for the purposes of this Part if it is or was at anytime within the financial year to which the accounts relate—

(a) a public company;

(b) a company licensed under the Banking Act;

(c) an insurance company registered under the Insurance Act;

(d) a licensee under the Securities Act;

(e) a company licensed under the Financial Institutions Act;

(f) a society registered under the Building Societies Act or the Cooperative Societies Act.

[No. ] The Companies Act, 2004346

Small Groups

9. Group accounts need not be prepared with respect to a holding company in relation to a financial year in which the holding company and its subsidiaries qualify as a small group and the holding company is not disqualified under paragraph 11.

10. A holding company and its subsidiaries qualify as a small group in relation to a financial year if they meet on a consolidated basis, two or more of the following criteria for that financial year and the immediately preceding financial years—

(a) the groups turnover is less than $80 million;

(b) the balance sheet total is less than $60 million;

(c) the total number of employees is less than 50.

11. A group of companies is disqualified for the purposes under this Part if any of the companies within that group is—

(a) a public company;

(b) a company licensed under the Banking Act;

(c) an insurance company registered [or exempted from registration] under the Insurance Act;

(d) a licensee under the Securities Act;

(e) a company licensed under the Financial Institutions Act;

(f) a society registered under the Building Societies Act or the Cooperative Societies Act.

12. A holding company shall not be treated as qualifying as a small company in relation to a financial year unless it and its subsidiaries qualifies as a small group in relation to a financial year.

EIGHTH SCHEDULE (Section 157)

Matters to be expressly stated in Auditors' Report

1. Whether they have obtained all the information and explanations which to the best of their knowledge and belief were necessary for the purposes of their audit.

2. Whether, in their opinion, proper books of account have been kept by the company, so far as appears from their examination of those books, and proper returns adequate for the purposes of their audit have been received from branches not visited by them.

347The Companies Act, 2004 [No. ]

3.—(1) Whether the company’s balance sheet and (unless it is framed as a consolidated profit and loss account) profit and loss account dealt with by the report are in agreement with the books of account and returns.

(2) Whether, in their opinion and to the best of their information and according to the explanations given them, the said accounts give the information required by the Act in the manner so required and give a true and fair view—

(a) in the case of the balance sheet, of the state of the company’s affairs as at the end of its financial year;

(b) in the case of the profit and loss account, of the profit or loss for its financial year;

(c) a statement of change in equity for its financial year; and

(d) a statement of change in finances for its financial year,

or, as the case may be, give a true and fair view thereof subject to the non- disclosure of any matters (to be indicated in the report) which by virtue of Part III of the Seventh Schedule are not required to be disclosed.

4. In the case of a holding company submitting group accounts whether, in their opinion, the group accounts have been properly prepared in accordance with the provisions of the Act so as to give a true and fair view of the state of affairs and profit or loss of the company and its subsidiaries dealt with thereby, so far as concerns members of the company, or, as the case may be, so as to give a true and fair view thereof.

NINTH SCHEDULE (Section 382)

Provisions referred to in section 382

Section or Provision of Schedule Subject Matter

–––––––––––––– –––––––––

13 Conclusiveness of certificate of incorporation.

26 Statement in lieu of prospectus to be delivered to Registrar by company on ceasing to be private company.

41 Specific requirements as to particulars in prospectus.

49 Prohibition of allotment in certain cases unless statement in lieu of prospectus delivered to Registrar.

52 Return as to allotments.

93 Registration of charges.

[No. ] The Companies Act, 2004348

95 Duty of company to register charges created by company.

96 Duty of company to register charges existing on property acquired.

102 Copies of instruments creating charges to be kept by company.

105 Application of Part III to charges created, and charges on property subject to charges acquired, by company incorporated outside the Island.

123 Annual return to be made by company not having share capital.

125 Certificates to be sent by private company with annual return.

127 Statutory meeting and statutory report.

157(1), (3) Auditors’ report and right to information and explanations.

175 Restrictions on appointment or advertisement of director.

299 Notice by liquidator of his appointment.

345(2) Abstract of receiver’s receipts and payments.

347 Delivery to Registrar of accounts of receivers and managers.

363 Documents, etc., to be delivered to Registrar by companies carrying on business in the Island.

365 Return to be delivered to Registrar where documents, etc., altered.

366 Accounts of company carrying on business in the Island.

367 Obligation to state name of company, whether limited, and country where incorporated.

5th Schedule Part 1 Paras 2, 4 and 5. Particulars in annual return of company

having a share capital.

349The Companies Act, 2004 [No. ]

TENTH SCHEDULE (Section 16)

Procedure in cases of applications for licences under section 16

1. The accompanying draft in the form marked “A” hereinafter set out have been prepared to show generally the manner in which the articles of incorporation should be framed where an association about to be formed as a limited company proposes to apply to the Minister for a licence under section 16 of the Act.

2. Under section 16 of the Act any chamber, institute, society, or other association formed for the purpose of promoting commerce, art, science, religion, charity, or any other useful object which does not involve the division of profit, may, if it obtains the licence of the Minister be incorporated by registration with limited liability, but without the addition of the word “limited” to its name.

3. It is to be understood that the drafts of the articles of incorporation are subject to such additions, alterations and omissions as the circumstances of the association desiring incorporation may render necessary or the Minister may require.

4. An association seeking to obtain the benefits of the said section should make a written application to the Minister for his licence and, together with such application, should transmit for consideration a draft in duplicate of the proposed articles of incorporation, together with a list of the promoters and proposed governing body of the association, and a report or statement of its previous proceedings as an unincorporated body. If the Minister is satisfied that the application may be entertained he will give instructions for a notice of such application in the form marked “B” hereinafter set out to be inserted in a daily newspaper printed and circulating in the Island for the information of the public once a week for two successive weeks and if after the expiration of fourteen days from the date of the last insertion there appears to be no sufficient reason why the licence should not be granted the Minister will accept the articles of incorporation with such amendment, if any, as may be necessary, and grant a licence. The fees for registration of the association are set out in the Fifteenth Schedule.

5. The Minister will not be responsible for the articles of incorporation being properly framed as regards the interests of the association. No fees or charges in respect of the licence are payable.

6. In the event of any proposed addition, alteration or amendment of the articles being required, the same shall be submitted to the Minister for his approval.

7. The procedure set forth in paragraph 4 with respect to the publication of a notice in a local daily newspaper is to apply in relation to an application by a company under section 16 (2) of the Act as it applies in relation to an application

[No. ] The Companies Act, 2004350

by an association under section 16(1) thereof with the omission of all the words appearing after the words “for his licence” in the first sentence of the paragraph and with the substitution for the words “will accept the articles of incorporation with such amendment” of the words “will accept the application subject to such conditions”.

(A)

Articles of Incorporation

(1) These articles are to be construed with reference to the provisions of the Companies Act, and terms used in these articles shall be taken as having the same respective meanings as they have when used in that Act.

(2) Qualification of members.

(3)Admission of members.

Names, addresses and descriptions of subscribers (as in articles).

* All names should be in full, and the addresses should be definite giving, where practicable, the name of the street and the number of the house.

It is proposed to adopt the style “Chamber” “society”, etc. throughout, and to avoid the use of the word “company”.

(4) Retirement of members.

(5) Rights of members.

(6) Honorary officers and their elections.

(7) Management of chamber.

(8) Powers of chamber (or of the council or governing body thereof).

Dated the day of

Witness

(B)

Notice of application for a licence from the Minister under section 16 of the Companies Act

Notice is hereby given that in pursuance of section 16 of the Companies Act, application has been made to the Minister for a licence whereby the

Limited (or an association about to be formed under the name of ) may operate with limited liability without the addition of the word “limited” to its name.

351The Companies Act, 2004 [No. ]

* The objects for which the association is proposed to be established are

Notice is hereby further given that any person, company or corporation objecting to this application may bring such objection before the Minister on or before the next by letter addressed to the Minister at the Ministry of Commerce and Technology, Kingston, Jamaica.

Dated this day of , .

Permanent Secretary, Ministry of Industry, Commerce and Technology.

–––––––––––––––––––––––––––––––––––––––––––––––––––––––––––– * Strike out in case of application by limited company.

ELEVENTH SCHEDULE (Section 391)

Provisions of this Act applied to unregistered companies

Limitations on Subject matter Provisions applied Application

––––––– ––––––––––– ––––––

Prospectuses and Sections 40 to 47, 51, To apply so far only as may allotments. 55 and the Third be specified by regulations

Schedule. made by the minister and to such bodies corporate as may be so specified.

Annual return. Sections 121 to 125 Not to apply so as to require and the Fifth particulars in respect of any Schedule. period before the appointed

day, and as respects any period thereafter to apply so far only as may be specified as aforesaid and to such bodies corporate as may be so specified.

Accounts and Sections 144 to 157, To apply so far only as may audit. 190 and 191, the be specified as aforesaid and

Eight Schedule (ex- to such bodies corporate as cept sub-paragraphs may be so specified. (a) to (d) of para- graph 2, sub-para- graphs (c), (d) and (e) of paragraph (3)

[No. ] The Companies Act, 2004352

and sub-paragraph (1) (c) of paragraph (8) and the Seventh Schedule.

Investigations. Sections 160 to 171. –––

Register of directors. Section 183. –––

Registration of Sections 2, 192, 353 To apply so far only as they documents, en- to354,381,382,389, have effect in relation to pro- forcement and 384,385,386,387, visions applying by virtue other supplemental 396 (1) and the of the foregoing entries in matters. Ninth Schedule and this Schedule.

Fifteenth Schedule.

TWELFTH SCHEDULE (Sections 25 (l) (e), 125)

Exceptions referred to at paragraph (e) of subsection (I) of section 25 General

1. The exceptions referred to at paragraph (e) of subsection (1) of section 25 of the Act to the requirement that a private company’s articles shall prohibit any person other than the holder from having any interest in any of the company’s shares (hereinafter referred to as the relevant requirement) are those provided for in the following paragraphs of this Schedule.

Interpretation

2. In this Schedule—

(a) the expression “banking or finance company” means any body corporate or partnership whose ordinary business includes the business of banking and any other body corporate whose ordinary business includes the business of lending money or of subscribing for shares, except, that it does not include any such other body corporate unless either—

(i) its shares are quoted or dealt in on a recognized stock exchange; or

(ii) it is designated for the purposes of this paragraph by order of the Minister; or

(iii) it is a subsidiary of a body corporate whose shares are so quoted or dealt in or which is so designated; and

(b) the expression “recognized stock exchange” means any body of persons carrying on business whether in Jamaica or elsewhere

353The Companies Act, 2004 [No. ]

declared by an order of the Minister to be a recognized stock exchange for the purposes of this paragraph.

Exceptions for normal Dealings of a business Nature

3.—(1) The rules contained in the following sub-paragraphs of this paragraph shall apply for the purposes both of the relevant requirement and of the exceptions from that requirement.

(2) Where any share or any interest in any share is subject to a charge in favour of a banking or finance company by way of security for the purposes of a transaction entered into in the ordinary course of its business as such—

(a) any interest under the charge, whether of the banking or finance company or a nominee for it, shall be disregarded; and

(b) if the banking or finance company or its nominee is the holder of the share, the person entitled to the equity of redemption shall be treated as the holder, whether he has a present right to redeem or not.

(3) Any interest under a contract for the transfer of any share or of any interest in any share shall, until execution of an instrument of transfer by the parties, be disregarded unless execution thereof is unreasonably delayed.

(4) Subject to sub-paragraph (2) of this paragraph, on execution of an instrument of transfer of a share, the transferee and not the transferor shall be treated as the holder, notwithstanding that the transfer requires registration with the company, unless registration is refused.

(5) Any interest of the company itself in any of its shares, and any lien or charge arising by operation of law and affecting any of the shares shall be disregarded.

Exceptions for Cases of Death and for family Settlements

4.—(1) The relevant requirement shall be subject to exceptions for—

(a) any shares forming part of the estate of a deceased holder thereof, so long as administration of his estate has not been completed; and

(b) any shares held by trustees on the trusts of a will or family settlement disposing of the shares, so long as no body corporate has for the time being any immediate interest under the said trusts other than—

(i) a body corporate established for charitable purposes only and having no right to exercise or control the exercise of any part of the voting power at any general meeting of the company;

(ii) a body corporate which is a trustee of the said trusts

[No. ] The Companies Act, 2004354

and has such an interest only by way of remuneration for acting as trustee thereof.

(2) For the purposes of this paragraph—

(a) shares held by trustees on trusts arising on an intestacy shall, if the shares or an interest therein formed part of the intestate’s estate at the time of his death, be treated as if the trusts arose under a will disposing of the shares;

(b) the expression “family settlement” means a settlement made either—

(i) in consideration or contemplation of an intended marriage of the settler or any of the settler’s issue or in pursuance of a contract entered into in consideration or contemplation of any such marriage; or

(ii) otherwise in favour of any of the following persons, that is to say, the settler, his parents and grandparents, and any other individual who at the date of the settlement is a member of the company, and the wife or husband and issue, and the wife or husband of any issue, of the settler, his parents, or any such other individual, and persons taking in the event of a failure of the issue or any class of the issue of any person taking under the settlement;

(c) the expressions “parent”, “grandparent” and “issue” shall be construed as if the stepchild, adopted child or illegitimate child of any person were that person’s child;

(d) any reference to a wife or husband shall include a former wife or husband and a reputed wife or husband;

(e) the expression “will” includes any testamentary disposition;

(f) any reference to a will or family settlement disposing of any shares shall include a will or family settlement disposing of an interest under another will or family settlement disposing of the shares.

Exception/for Cases of Disability

5. Where the person entitled to any share or any interest in any share is of unsound mind or otherwise under any disability, and by reason thereof the share or interest is vested in an administrator or other person on behalf of the person entitled thereto, then in relation to the share or interest the person in

355The Companies Act, 2004 [No. ]

whom it is so vested and the person entitled thereto shall be treated for the purposes of this Schedule as if they were the same person.

Exception for Trusts for Employees

6. The relevant requirement shall be subject to an exception for any shares held by trustees for the purposes of a scheme maintained for the benefit of employees of the company, including any director holding a salaried employment or office in the company.

Exceptions for Bankruptcies, Liquidations, etc.

7. The relevant requirement shall be subject to exceptions for—

(a) any shares forming part of the assets in a bankruptcy or liquidation of a holder thereof; and

(b) any shares held either—

(i) on trusts created for the benefit of his creditors generally by a person having an interest therein; or

(ii) otherwise for the purposes of any composition or scheme made or approved under any statute by a court or an officer of a court for arranging the affairs of such a person.

Exception for Holdings of Nominees for Banking or Finance Companies providing Capital

8. The relevant requirement shall be subject to an exception for any shares held by a nominee for a banking or finance company where the interest of the banking or finance company in the shares was required in the ordinary course of the business of the banking or finance company as such, and by arrangement with the company or its promoters:

Provided that this exception shall not apply if the banking or finance company has the right (or, where there is more than one such company having an interest in shares to which this exception applies, they have between them the right) to control the exercise of one-fifth or more of the total voting power at any general meeting of the company.

Limited Exception for Certain Other Nominee Holdings

9. The relevant requirement shall be subject to an exception for any share held by not more than one member (hereinafter referred to as the relevant shareholder) of the company holding such share in trust for a member of the company or subject to any arrangement whereby a member of the company has any right to become holder thereof (whether on payment or not):

[No. ] The Companies Act, 2004356

Provided that this exception shall not apply if the relevant shareholder holds more than a single share.

THIRTEENTH SCHEDULE (Section 25 (3))

Exceptions referred to at subsection (3) of section 25

1. The exceptions referred to at subsection (3) of section 25 to the obligation imposed upon a private company to file accounts if any of its shares is held by a body corporate (hereinafter referred to as the relevant obligation) are those provided for in the following paragraphs of this Schedule.

2. The provisions of paragraphs 2 of the Twelfth Schedule and the exceptions specified in paragraphs 3 to 7 inclusive of that Schedule shall, with the necessary modifications, apply in relation to the relevant obligation as they apply in relation to the relevant requirement mentioned in paragraph I of that Schedule.

Exception for Shares held by Private Companies

3.—(1) The relevant obligation shall also be subject to an exception for shares held by another private company which is not obliged to file accounts:

Provided that this exception shall not apply if taking all the following companies together, that is to say—

(a) the company whose obligation to file accounts is in question (hereafter in this Schedule referred to as the relevant company);

(b) any company holding shares to which this exception has to be applied in determining the relevant company’s right to be treated as a private company which is not obliged to file accounts; and

(c) any further company taken into account for the purposes of this proviso in determining the right to be so treated of any company holding any such shares as aforesaid,

the total number of persons holding shares in those companies is more than twenty, joint shareholders being treated as a single person and the companies themselves and (subject to sub-paragraph (3)) their employees and former employees being disregarded.

(2) Where the relevant company and another company hold shares in each other, the other company shall be treated for the purposes of sub-paragraph (l) as a private company which is not obliged to file accounts if—

(a) in determining its right to be so treated the exception in that sub- paragraph would apply to the shares in it held by the relevant company, on the assumption that the relevant company was a private company which is not obliged to file accounts; and

357The Companies Act, 2004 [No. ]

(b) in all other respects the other company is entitled to be so treated,

and where another company’s right to be so treated depends on the application to any shares in it of that sub-paragraph, and the application thereof to those shares depends indirectly on the relevant company’s right to be so treated, this sub-paragraph shall apply as if those shares were held by the relevant company.

(3) In the proviso to sub-paragraph (1) the direction that employees and former employees of the companies shall be disregarded in computing the number of shareholders shall not apply to a person holding shares in a company of which he is not for the time being an employee unless, having been formerly in the employment of that company, he held, while in that employment, and has continued after the determination of that employment to hold shares in that company.

Exception for Banking or Finance Companies Providing Capital

4. The relevant obligation shall also be subject to an exception for any shares held by a banking or finance company, where the banking or finance company acquired the shares in the ordinary course of its business as such and by arrangement with the relevant company or its promoters:

Provided that this exception shall not apply if the banking or finance company has the right (or, where there is more than one such company holding shares to which this exception has to be applied in determining the relevant company’s right to be treated as a private company which is not obliged to file accounts, they have between them the right) to exercise or control the exercise of one-fifth or more of the total voting power at any general meeting of the relevant company.

FOURTEENTH SCHEDULE (Section 196)

Provisions supplementing and interpreting section 196

PART I

Rules for interpretation of the sections

1.—(1) A reference to an interest in shares or debentures is to be read as including any interest of any kind whatsoever in shares or debentures.

(2) Accordingly, there are to be disregarded any restraints or restrictions to which the exercise of any right attached to the interest is or may be subject.

2. Where property is held on trust and any interest in shares or debentures is comprised in the property, any beneficiary of the trust who (apart from this paragraph) does not have an interest in the shares or debentures is to be taken as having such an interest; but this paragraph is without prejudice to the following provisions of this Part of this Schedule.

3.—(1) A person is taken to have an interest in shares or debentures if—

[No. ] The Companies Act, 2004358

(a) he enters into a contract for their purchase by him (whether for cash or other consideration); or

(b) not being the registered holder, he is entitled to exercise any right conferred by the holding of the shares or debentures or is entitled to control the exercise of any such right.

(2) For the purposes of sub-paragraph (1) (b), a person is taken to be entitled to exercise or control the exercise of a right conferred by the holding of shares or debentures if he—

(a) has a right (whether subject to conditions or not) the exercise of which would make him so entitled; or

(b) is under an obligation (whether or not so subject) the fulfilment of which would make him so entitled.

(3)Aperson is not by virtue of sub-paragraph (1) (b) taken to be interested in shares or debentures by reason only that he—

(a) has been appointed a proxy to vote at a specified meeting of a company or of any class of its members and at any adjournment of that meeting; or

(b) has been appointed by a corporation to act as its representative at any meeting of a company or of any class of its members.

(4) A person is taken to be interested in shares or debentures if a body corporate is interested in them and—

(a) that body corporate or its directors are accustomed to act in accordance with his directions or instructions; or

(b) he is entitled to exercise or control the exercise of one-third or more of the voting power at general meetings of that body corporate.

5. Where a person is entitled to exercise or control the exercise of one-third or more of the voting power at general meetings of a body corporate and that body corporate is entitled to exercise or control the exercise of any of the voting power at general meetings of another body corporate (“the effective voting power”) then, for the purposes of paragraph 4 (b), the effective voting power is taken to be exercisable by that person.

6.—(1) A person is taken to have an interest in shares or debentures if, otherwise than by virtue of having an interest under a trust—

(a) he has a right to call for delivery of the shares or debentures to himself or to his order; or

359The Companies Act, 2004 [No. ]

(b) he has a right to acquire an interest in shares or debentures or is under an obligation to take an interest in shares or debentures, whether in any case the right or obligation is conditional or absolute.

(2) Rights or obligations to subscribe for shares or debentures are not to be taken, for purposes of sub-paragraph (1), to be rights to acquire, or obligations to take, an interest in shares or debentures.

7. Persons having a joint interest are each deemed to have that interest.

8. It is immaterial that shares or debentures in which a person has an interest are unidentifiable.

9. So long as a person is entitled to receive, during the lifetime of himself or another, income from trust property comprising shares or debentures, an interest in the shares or debentures in reversion or remainder are to be disregarded.

10. A person is to be treated as uninterested in shares or debentures if, and so long as, he holds them as a trustee.

11. Delivery to a person’s order of shares or debentures in fulfilment of a contract for the purchase of them by him or in satisfaction of a right of his to call for their delivery, or failure to deliver shares or debentures in accordance with the terms of such a contract or on which such a right falls to be satisfied, is deemed to constitute an event in consequence of the occurrence of which he ceases to be interested in them, and so is the lapse of a person’s right to call for delivery of shares or debentures.

PART II

Periods within which obligations imposed by section 196 must be fulfilled

12.—(1) An obligation imposed on a person by section 196 (1) to notify an interest must, if he knows of the existence of the interest on the day on which he becomes a director, be fulfilled before the expiration of the period of 5 days beginning with the day following that day.

(2) Otherwise, the obligation must be fulfilled before the expiration of the period of 5 days beginning with the day following that on which the existence of the interest comes to his knowledge.

13.—(1) An obligation imposed on a person by section 196 (2) to notify the occurrence of an event must, if at the time at which the event occurs he knows of its occurrence and of the fact that its occurrence gives rise to the obligation, be fulfilled before the expiration of the period of 5 days beginning with the day following that on which the event occurs.

[No. ] The Companies Act, 2004360

(2) Otherwise, the obligation must be fulfilled before the expiration of a period of 5 days beginning with the day following that on which the fact that the occurrence of the event gives rise to the obligation comes to his knowledge.

PART III

Circumstances in which obligation imposed by section 196 not discharged

14.—(1) Where an event of whose occurrence a director is, by virtue of section 196 (2) (a), under an obligation to notify a company consists of his entering into a contract for the purchase by him of shares or debentures, the obligation is not discharged in the absence of inclusion in the notice of a statement of the price to be paid by him under the contract.

(2) An obligation imposed on a director by section 196 (2) (b) is not discharged in the absence of inclusion in the notice of the price to be received by him under the contract.

15.—(1)An obligation imposed on a director by virtue of section 196 (2) (c) to notify a company is not discharged in the absence of inclusion in the notice of a statement of the consideration for the assignment (or, if it be the case that there is no consideration, that fact).

(2) Where an event of whose occurrence a director is, by virtue of section 196 (2) (d), under obligation to notify a company consists in his assigning a right, the obligation is not discharged in the absence of inclusion in the notice of a similar statement.

16.—(1) Where an event of whose occurrence a director is, by virtue of section 196 (2) (d), under an obligation to notify a company consists in the grant to him of a right to subscribe for shares or debentures, the obligation is not discharged in the absence of inclusion in the notice of a statement of—

(a) the date on which the right was granted;

(b) the period during which or the time at which the right is exercisable;

(c) the consideration for the grant (or, if it be the case that there is no consideration, that fact); and

(d) the price to be paid for the shares or debentures.

(2) Where an event of whose occurrence a director is, by section 196 (2) (d), under obligation to notify a company consists in the exercise of a right granted to him to subscribe for shares or debentures, the obligation is not discharged in the absence of inclusion in the notice of a statement of—

(a) the number of shares or amount of debentures in respect of which the right was exercised; and

(b) if it be the case that they were registered in his name, that fact, and,

361The Companies Act, 2004 [No. ]

if not, the name or names of the person or persons in whose name or names they were registered, together (if they were registered in the names of 2 persons or more) with the number or amount registered in the name of each person.

17. In this Part, a reference to price paid or received includes any consideration other than money.

PART IV

Provisions with respect to register of Directors’ interests to be kept under section 196

18. The register must be so made up that the entries in it against the several names appear in chronological order.

19.An obligation imposed by section 196 (2) to (4) must be fulfilled before the expiration of the period of 3 days beginning with the day after that on which the obligation arises.

20. The nature and extent of an interest recorded in the register of a director in any shares or debentures shall, if he so requires, be recorded in the register.

21. The company is not, by virtue of anything done for the purposes of section 196 or this Part of this Schedule, affected with notice of, or put upon enquiry as to, the rights of any person in relation to any shares or debentures.

22. The register shall—

(a) if the company’s register of members is kept at its registered office, be kept there;

(b) if the company’s register of members is not so kept, be kept at the company’s registered office or at the place where its register of members is kept,

and shall, during business hours, be open to inspection of any member of the company without charge and of any other person on payment of Fifty Dollars.

23.—(1) Any member of the company or other person may require a copy of the register, or of any part of it, on payment of Fifty Dollars.

(2) The company shall cause any copy so required by a person to be sent to him within the period of 10 days beginning with the day after that on which the requirement is received by the company.

24. The company shall send notice in the prescribed form to the Registrar of the place where the register is kept and of any change in that place except in a case in which it has at all times been kept at its registered office.

[No. ] The Companies Act, 2004362

25. Unless the register is in such a form as to constitute in itself an index, the company shall keep an index of the names inscribed in it, which shall—

(a) in respect of each name, contain a sufficient indication to enable the information entered against to be readily found; and

(b) be kept at the same place as the register,

and the company shall, within 14 days after the date on which a name is entered

in the register, make any necessary alteration in the index.

26. The register shall be produced at the commencement of the company’s annual general meeting and remain open and accessible during the continuance of the meeting to any person attending the meeting.

FIFTEENTH SCHEDULE (Section 394)

Table of Fees

Matter in respect of which fees are payable Amount of Fees

–––––––– ––––––

For registration of a company limited by shares ... ... ... $7,000.00

For registration of a company not having a share capital ... ... ... $7,000.00

For the registration of a company limited by guarantee and having a share capital or an unlimited company having a share capital $7,000.00

For the registration of an increase in the share capital of any company—

Notice of increase of share capital ... $1,200.00

Statement of increase of share capital $1,200.00

Ordinary Resolution for increase in share capital ... ... ... $1,200.00

Overseas Company ... ... ... ... $7,000.00

For registering the Annual Return ... ... ... $3,000.00

For registering any charge ... ... ... ... $2,300.00

Registering Amended Memorandum or Articles of Association ... ... ... ... ... $2,000.00

For registering any other document by the Act

363The Companies Act, 2004 [No. ]

required or authorized to be registered or required to be delivered, sent or forwarded to the Registrar other than the Memorandum or the abstract required to be delivered to the Registrar by a receiver or manager or the statement required to be sent to the Registrar by the Liquidator in a winding up ... ... $1,200.00

For making a record of any fact by the Act required or authorized to be recorded by the Registrar ... ... ... ... ... $1,200.00

For inspection of documents kept by the Registrar ... $100.00 for the first 30 minutes and $50.00 for each additional 30 minute period or part thereof

For a certified copy of a certificate of incorporation ... ... ... ... ... $500.00

For a certified copy of any document or part of any document kept by the Registrar or extract therefrom ... ... ... ... $100.00 for

each page

For change of name of a company ... ... ... $2,000.00

For an uncertified copy of any document or part of any document kept by the Registrar [or extract therefrom] per page ... ... ... $50.00

For registering a prospectus ... ... ... $10,000.00

For registering a rights issue ... ... ... $5,000.00

For a certificate of Good Standing from the Registrar of Companies ... ... ... ... $1,000.00

For a Registrar's Report on the status of a company ... ... ... ... ... ... $1,000.00

Fees for removal at the request of the company (not including advertisement) ... ... ... $1,500.00

For the late registration of any document required to be filed ... ... ... ... $200.00

For the expedition of registration ... ... ... $1,000.00

[No. ] The Companies Act, 2004364

For supplying information via facsimile (per page) U.S., Canada, Caribbean ... ... ... ... $200.00

Jamaica ... ... ... ... ... ... $50.00

Other countries ... ... ... ... $300.00

Fees for services to Government Agencies/ Public Bodies:

For letters/Extracts verifying records ... $500.00

For opinions/research ... ... ... $2,000.00

For concluding research upon request ... $1,000.00

For database on diskettes ... ... ... $5,000.00

For database in print ... ... ... $10,000.00

For report on Companies by sector ... ... $4,000.00

Service of summons ... ... ... $1,000.00

Attendance at Court by non-legal staff (one day or part thereof);

Supreme Court ... ... ... ... $800.00

Resident Magistrate's Court ... ... $400.00

Attendance at Court—Legal Officers (one day or part thereof); Supreme Court

Senior Counsel ... ... ... $15,000.00

Junior Counsel ... ... ... $8,000.00

Resident Magistrate's Court

Senior Counsel ... ... ... $10,000.00

Junior Counsel ... ... $5,000.00.".

PRINTED BY JAMAICA PRINTING SERVICES (1992) LTD., (GOVERNMENT PRINTERS), DUKE STREET, KINGSTON, JAMAICA

365The Companies Act, 2004 [No. ]

Passed in the Honourable Senate this 4th day of March, 2004.

SYRINGA MARSHALL-BURNETT, C.D., President.

This printed impression has been carefully compared by me with the Bill which has passed the House of Representatives and Senate, and has been found by me to be a true and correct printed copy of the said Bill.

Clerk to the Houses of Parliament.

[No. ] The Companies Act, 2004366

Passed in the Honourable Senate this 4th day of March, 2004.

SYRINGA MARSHALL-BURNETT, C.D., President.

This printed impression has been carefully compared by me with the authenticated impression of the foregoing Act, and has been found by me to be a true and correct printed copy of the said Act.

Clerk to the Houses of Parliament.

365The Companies Act, 2004 [No. ]

367The Companies Act, 2004 [No. ]

MEMORANDUM OF OBJECTS AND REASONS

In August 1990, the Cabinet appointed a Committee the terms of reference of which were “to review the existing state of company law in Jamaica and to make recommendations as to the changes which are necessary or desirable for the modernization of the law, taking into account the harmonization of Company Law in the Commonwealth Caribbean”.

The Government decided to accept the recommendations of that Committee as the basis of making the necessary changes in the Companies Act.

This Bill therefore seeks to repeal and replace the Companies Act in order to give effect to that decision.

The Bill contains provisions inter alia for—

(a) simplification of company formation by incorporation by a single document and recognition of the “sole member” company;

(b) minimum capitalization of companies having a share capital;

(c) shares to be issued without a par value attaching thereto, and in this regard where non-cash consideration is tendered in exchange for shares issued, independent experts should be required to verify that the consideration is at least equal to the value of the shares;

(d) the operation of stated capital accounts by companies, stated capital being defined as including—

(i) the total issue price (including non-cash consideration) of all classes of shares;

(ii) the full value of transfers to capital by the company from profits or revenue reserves, including the total issue price of bonus shares issued upon a capitalization of profits or revenue reserves;

(iii) the full value of transfers to capital from profits or revenue reserves;

(e) liquidity/solvency tests to be followed for payment or dividends and the redemption of redeemable shares and the purchase by a company of its own shares;

(f) the adoption of pre-incorporation contracts made on a company’s behalf by the company after incorporation;

(g) the abolition of the ulta vires doctrine and the doctrine of constructive notice of a company’s constituent documents and the vesting of company with the capacity, rights, powers and privileges of a natural person;

[No. ] The Companies Act, 2004368

(h) empowering directors to take account of the interests of employees and the community as legitimate objects in their own right on the corporate agenda;

(i) duties of directors and the standard of care and skill required of directors and in this regard—

(i) a more rigorous standard is prescribed for managing/ executive directors;

(ii) the court is empowered to disqualify a director on the ground of unfitness for a maximum limit of 5 years, upon application for such an order is made by the Registrar of Companies, members of a company’s board and members and creditors of a company;

(j) permitting companies to conclude contracts with their directors if full disclosure of the nature and extent of such contracts is made to the board;

(k) prohibiting the making, by public companies of loans or other forms of financial assistance to directors, shareholders or officers of companies or associates of such persons, subject to certain exceptions;

(1) providing criminal sanctions for insider trading and prescribing civil remedies in respect of such activity;

(m) permitting individual members to bring derivative action in the company’s name with the leave of the court;

(n) registration of charges and dealings in securities (excluding charges on land) and in this regard—

(i) the law confirms the established principle that a prior mortgagee/chargee with knowledge of a later charge cannot thereafter upstamp a security to the prejudice of the later chargee;

(ii) the Registrar is empowered to note on the register the fact of out of time lodgements of documents for registration of a mortgage;

(iii) provision is made whereby registration of particulars of a mortgage at the Companies Registry constitutes notice to the world of the existence of the document and its contents;

(o) the court is empowered, upon application, to appoint an administrator of a company facing impending insolvency who will

369The Companies Act, 2004 [No. ]

assume management of the company so as to ensure, among other things, its survival as a going concern or a more beneficial realization of its assets than would result on a winding up;

(p) the court is empowered—

(i) to disqualify directors of insolvent companies on the ground of wrongful or fraudulent trading or unfitness to act;

(ii) to disqualify, for a specific period, company directors from their office or any office of company management, for persistent breaches of companies legislation requiring the submission of returns, notices or other documents to the Registrar;

(q) the exemption of certain professionals such as accountants and attorneys-at-law as well as other prescribed groups of professionals, from the restrictions regarding the maximum number of persons in a partnership.

The Bill also makes provisions for extensive rules to be made with regard to the preparation of balance sheet and profit and loss accounts and setting out the required formats in relation thereto.

The Bill also expressly provides that redundancy payments owed to company employees on a winding up constitute preferential debts, regardless of whether the payment falls due before or after the appointment of a receiver.

PHILLIP PAULWELL, Minister of Industry, Commerce and Technology.

[No. ] The Companies Act, 2004370 A

B IL

L EN

TITLED

A N

A C

T to

R epealand

replace the

C om

panies A

ct

________________________________________

A s

passed by

the H

onourable H

ouse of

R epresentatives

––––––––––––––––––––––––––––––––––––

__________________________________________

PR IN

T E

D B

Y JA

M A

IC A

PR IN

T IN

G SE

R V

IC E

S (1992)

LT D

.,

(G O

V E

R N

M E

N T

PR IN

T E

R S),

D U

K E

ST R

E E

T, K

IN G

ST O

N ,

JA M

A IC

A .

––––––––––––––––––––––––––––––––––––

371The Companies Act, 2004 [No. ]


立法 被以下文本实施 (1 文本) 被以下文本实施 (1 文本)
无可用数据。

WIPO Lex编号 JM043